BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P24 (931 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0178 + 6195402-6199158,6199438-6200003 29 5.3 11_01_0551 + 4361640-4363386,4363443-4363687 29 7.0 >03_02_0178 + 6195402-6199158,6199438-6200003 Length = 1440 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +1 Query: 580 RRSSQRWRNPTGL*RYQAFPPGSSLVRSPXXDPCRLP 690 RR S WR+ GL Y+A P S SP P RLP Sbjct: 113 RRQSGGWRDSEGLDGYRAAPRRSG--ASPPTPPLRLP 147 >11_01_0551 + 4361640-4363386,4363443-4363687 Length = 663 Score = 28.7 bits (61), Expect = 7.0 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = +2 Query: 533 WRFSIGSAPLTSITKID--AQVRGGETRQDYKDTRRF-PLEAPSCALLXPTPAAYRIPVR 703 WR SA I +D A ++ +T Y+ R P P+C L P+P YR P+R Sbjct: 341 WRLCNTSAGADYIPCLDNEAAIKKLKTTAHYEHRERHCPASPPTC--LVPSPEGYRDPIR 398 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,135,870 Number of Sequences: 37544 Number of extensions: 486678 Number of successful extensions: 1361 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1361 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2659245980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -