BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P22 (890 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 25 2.3 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 24 5.4 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 25.4 bits (53), Expect = 2.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 310 SWLCKEPGLQWNSILQYLP*FPV 242 SW KEP WN I YLP P+ Sbjct: 174 SW--KEPPFTWNEIGSYLPTSPL 194 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 703 SDKEIEGGELRWVKMTNNSSLPMDAIVGGYEN 798 SD +E + +W ++ + D ++GGY N Sbjct: 95 SDLTVEEYKRKWTEIVSMLPRNRDTVIGGYVN 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,244 Number of Sequences: 2352 Number of extensions: 16795 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -