BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P18 (912 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 227 8e-62 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 5.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 6.7 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 6.7 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 227 bits (556), Expect = 8e-62 Identities = 102/126 (80%), Positives = 117/126 (92%) Frame = +1 Query: 136 MSWQDYVDKQLMASRCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGG 315 MS QDYVDKQL+ASRCVTKAAIAGHDGN+WAKSEGFE+SK+E+ K+V GFE + +LTS G Sbjct: 1 MSCQDYVDKQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSG 60 Query: 316 VTIAGTRYIYLSGTDHIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLGEY 495 VT+AG RYIYLSGTD +IRAKLGKVGVHCMKT QAVV+SLYE+PIQPQQAASVVEKLG+Y Sbjct: 61 VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY 120 Query: 496 LITCGY 513 L++CGY Sbjct: 121 LVSCGY 126 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 5.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 453 LDGFFIERNDHSLLCLH 403 + G IER DH++LC++ Sbjct: 327 ISGAPIERPDHAVLCVY 343 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 6.7 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = -3 Query: 235 PTL-PTHCHHDRQWQLL*HI 179 PT+ P H HH Q Q L H+ Sbjct: 345 PTMGPPHHHHHHQTQSLQHL 364 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 6.7 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +1 Query: 148 DYVDKQLMASRCVTKAAIAGHDGN 219 D + L RC K G DGN Sbjct: 447 DVISGNLEKGRCTGKIVTVGSDGN 470 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,987 Number of Sequences: 438 Number of extensions: 5000 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29630055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -