BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P09 (950 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 5.4 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 7.1 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 7.1 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 7.1 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 7.1 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 5.4 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 390 NVLNSLCNFFEMKFHIIKCRFGINQNLYGINNNPKIVLIQFIGKF 256 NV +C+ + ++F + ++GI QN +I ++ G F Sbjct: 48 NVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMF 92 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 7.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 680 SSRSNNISDGFNNYYKWY*N 621 SS SNN + NNY K Y N Sbjct: 83 SSLSNNYNYNNNNYKKLYCN 102 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 7.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 680 SSRSNNISDGFNNYYKWY*N 621 SS SNN + NNY K Y N Sbjct: 83 SSLSNNYNYNNNNYKKLYCN 102 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 7.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 680 SSRSNNISDGFNNYYKWY*N 621 SS SNN + NNY K Y N Sbjct: 83 SSLSNNYNYNNNNYKKLYCN 102 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 7.1 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 614 TLYFNTIYSNY*NHQKYYS 670 T++ N Y+NY N + YY+ Sbjct: 311 TIHNNNNYNNYNNKKLYYN 329 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,444 Number of Sequences: 438 Number of extensions: 2986 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31202262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -