BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P08 (871 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17D1.03c |||exosome subunit Rrp43 |Schizosaccharomyces pombe... 29 1.1 SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|... 28 2.0 SPBC13E7.11 ||SPBC30D10.19c|mitochondrial rhomboid protease|Schi... 26 6.1 SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces... 26 8.0 >SPBC17D1.03c |||exosome subunit Rrp43 |Schizosaccharomyces pombe|chr 2|||Manual Length = 270 Score = 28.7 bits (61), Expect = 1.1 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 263 FYSRNRWVEYSDKYYLNYDGSQVPAEW 343 F + WV Y+D LNYDGS W Sbjct: 139 FEKKAAWVLYADIICLNYDGSAFDYAW 165 >SPBPB2B2.02 |mug180||esterase/lipase |Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 27.9 bits (59), Expect = 2.0 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = +2 Query: 197 VKDGVLVGEDKYGNKYYENPRFFYSRNRWVEYSDKYYLNYDGSQVP-AEWFGWLHYKTDL 373 VKD + D G+ +N + S N Y +K+ YD +P + W ++ T Sbjct: 58 VKDVRIFFHDSIGSTLLKNRKKLNSENELPNYGEKFTHKYDNQDMPDSVWLAKVNGMTKS 117 Query: 374 PP 379 P Sbjct: 118 DP 119 >SPBC13E7.11 ||SPBC30D10.19c|mitochondrial rhomboid protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 298 Score = 26.2 bits (55), Expect = 6.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 414 WRTTPKIFLARPPNMCRTVRPDPKWKP 494 W+ K F RP ++P P WKP Sbjct: 11 WKFGQKRFYYRPWIRIENIKPTPLWKP 37 >SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces pombe|chr 3|||Manual Length = 693 Score = 25.8 bits (54), Expect = 8.0 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = +2 Query: 224 DKYGNKYYENPRFFYSRNRWVEYSDKYYLNYDGSQVPAE 340 DKY Y YS N W+++ K+ + + P + Sbjct: 565 DKYNKDIYIGSTVCYSPNEWLDFFSKFQQPREALKFPED 603 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,289,576 Number of Sequences: 5004 Number of extensions: 72725 Number of successful extensions: 193 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 434475230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -