BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P06 (860 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0479 + 3606663-3607448 29 0.25 09_02_0603 - 11150739-11150746,11150791-11151340 29 6.3 >07_01_0479 + 3606663-3607448 Length = 261 Score = 29.5 bits (63), Expect(2) = 0.25 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -2 Query: 505 GGPPFXKXXFXPPXLXGXPPXXXXEKFPPXXKXGXPPPXXXP 380 G PP P G PP PP + G PPP P Sbjct: 211 GPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGP 252 Score = 22.6 bits (46), Expect(2) = 0.25 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 643 FXGGXPPPGGXF 608 F GG PPP G F Sbjct: 197 FPGGPPPPPGPF 208 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 500 PXXSXKXFXXPPPXGXPPXX*XGK-IPPXXKTGXXPPXXXPXFF 372 P F PPP G PP G P ++G PP FF Sbjct: 28 PRLEKGNFALPPPFGFPPPPPPGSTFVPLPQSGVPPPPPLGSFF 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,963,683 Number of Sequences: 37544 Number of extensions: 247262 Number of successful extensions: 354 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -