BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P03 (992 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22G7.02 |kap111||karyopherin Kap111|Schizosaccharomyces pomb... 28 1.8 SPAC9.12c |atp12||F1-ATPase chaperone Atp12 |Schizosaccharomyces... 26 9.5 >SPAC22G7.02 |kap111||karyopherin Kap111|Schizosaccharomyces pombe|chr 1|||Manual Length = 990 Score = 28.3 bits (60), Expect = 1.8 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +1 Query: 79 VKISLIVIFAVVHAAATRL---ACRSDCELCVTCES*MGS*VEVYMILVE 219 + ISL V+F +H + T + RS LC TC S + + ++ +M +VE Sbjct: 549 LNISLPVLFDALHISETSIQMTVSRSIHTLCTTCASHLLTEIDGFMAVVE 598 >SPAC9.12c |atp12||F1-ATPase chaperone Atp12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 25.8 bits (54), Expect = 9.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 15 RLTIGNSLRFGTCRSYFRQKNS*NITYSNFRR 110 RL+ N L F TC S++ K S + +FRR Sbjct: 9 RLSSKNLLSFKTCYSFYSTKASSPLPQPSFRR 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,230,563 Number of Sequences: 5004 Number of extensions: 28837 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 513276802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -