BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P01 (918 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0NDG7 Cluster: ENSANGP00000030449; n=2; Diptera|Rep: E... 78 3e-13 UniRef50_Q8TBK6 Cluster: Zinc finger CCHC domain-containing prot... 72 2e-11 UniRef50_Q9VF05 Cluster: CG5516-PA; n=2; Endopterygota|Rep: CG55... 69 2e-10 UniRef50_UPI00015B5C23 Cluster: PREDICTED: similar to zinc finge... 67 7e-10 UniRef50_A7T6T1 Cluster: Predicted protein; n=1; Nematostella ve... 58 3e-07 UniRef50_Q54C90 Cluster: Putative uncharacterized protein; n=1; ... 51 4e-05 UniRef50_Q9FGX7 Cluster: Similarity to unknown protein; n=5; Mag... 50 8e-05 UniRef50_UPI0000587099 Cluster: PREDICTED: similar to ZCCHC10 pr... 50 1e-04 UniRef50_A0E2U0 Cluster: Chromosome undetermined scaffold_75, wh... 47 6e-04 UniRef50_Q55V50 Cluster: Putative uncharacterized protein; n=1; ... 47 6e-04 UniRef50_UPI00006CB052 Cluster: hypothetical protein TTHERM_0023... 46 0.002 UniRef50_Q0US55 Cluster: Putative uncharacterized protein; n=2; ... 42 0.022 UniRef50_A2QQ15 Cluster: Similarity: the predicted ORF may be N-... 38 0.36 UniRef50_Q5NRP7 Cluster: Putative gag-pol polyprotein, identical... 37 0.63 UniRef50_Q868S9 Cluster: Gag-like protein; n=1; Anopheles gambia... 35 2.5 UniRef50_Q8MY21 Cluster: Gag-like protein; n=2; Forficula scudde... 34 5.9 UniRef50_Q4D9Y6 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q4Z4M7 Cluster: Putative uncharacterized protein; n=2; ... 33 7.7 UniRef50_Q24362 Cluster: Putative ORF1; n=2; melanogaster subgro... 33 7.7 UniRef50_Q241W0 Cluster: Putative uncharacterized protein; n=1; ... 33 7.7 UniRef50_A7RK63 Cluster: Predicted protein; n=1; Nematostella ve... 33 7.7 >UniRef50_A0NDG7 Cluster: ENSANGP00000030449; n=2; Diptera|Rep: ENSANGP00000030449 - Anopheles gambiae str. PEST Length = 252 Score = 78.2 bits (184), Expect = 3e-13 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +3 Query: 90 FPQGIRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLK--AKEEGQCSNGS 245 FP+GIRCQKCLEFGHWSYEC+GKRK L R SRT+++ KNL + G + G+ Sbjct: 21 FPKGIRCQKCLEFGHWSYECQGKRKYLHRSSRTQVLKKNLNKIGSKNGDAATGT 74 >UniRef50_Q8TBK6 Cluster: Zinc finger CCHC domain-containing protein 10; n=35; Euteleostomi|Rep: Zinc finger CCHC domain-containing protein 10 - Homo sapiens (Human) Length = 192 Score = 72.1 bits (169), Expect = 2e-11 Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 3/62 (4%) Frame = +3 Query: 96 QGIRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEG---QCSNGSCKIPNKK 266 Q +RCQKCLEFGHW+YEC GKRK L RPSRT + K LK KE Q S G + K Sbjct: 41 QHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA 100 Query: 267 KR 272 K+ Sbjct: 101 KK 102 >UniRef50_Q9VF05 Cluster: CG5516-PA; n=2; Endopterygota|Rep: CG5516-PA - Drosophila melanogaster (Fruit fly) Length = 176 Score = 68.9 bits (161), Expect = 2e-10 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +3 Query: 90 FPQGIRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKE 221 FP GIRCQKCL+ GHWSYECK KRK + R SRT+ + K + KE Sbjct: 24 FPNGIRCQKCLQIGHWSYECKEKRKYVHRSSRTKQLSKRMSQKE 67 >UniRef50_UPI00015B5C23 Cluster: PREDICTED: similar to zinc finger, CCHC domain containing 10; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to zinc finger, CCHC domain containing 10 - Nasonia vitripennis Length = 159 Score = 66.9 bits (156), Expect = 7e-10 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +3 Query: 102 IRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCSN--GSCKIPNKKK 269 +RCQKCLE GHWSYECKGKRK L R SRT + K L+ K E + +N + + P KK Sbjct: 23 VRCQKCLEMGHWSYECKGKRKYLHRNSRTVQLKKALEKKPEDRFNNEASNTEEPTNKK 80 >UniRef50_A7T6T1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 55 Score = 58.0 bits (134), Expect = 3e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +3 Query: 105 RCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKA 215 +CQKCL+ GHW+YEC KRK L R SRT +M+K KA Sbjct: 6 KCQKCLQIGHWTYECTNKRKYLHRMSRTTVMNKKWKA 42 >UniRef50_Q54C90 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 204 Score = 51.2 bits (117), Expect = 4e-05 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +3 Query: 108 CQKCLEFGHWSYECKGKRKILVRPSRTRIMH-KNLKAKEEGQCSNGSCKIPNKKKR 272 CQKCL+FGH S+ECK K + RP+RT +++ K L K GS K ++K++ Sbjct: 9 CQKCLQFGHLSFECKSKPLYVSRPTRTALLNDKKLLEKTLNSYQKGSTKDNDEKEK 64 >UniRef50_Q9FGX7 Cluster: Similarity to unknown protein; n=5; Magnoliophyta|Rep: Similarity to unknown protein - Arabidopsis thaliana (Mouse-ear cress) Length = 280 Score = 50.0 bits (114), Expect = 8e-05 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +3 Query: 105 RCQKCLEFGHWSYECKGKRKILVRPSRT-RIMHKNLKAKEEGQCSNGS 245 +CQKC + GHW+YECK +R + RPSRT ++ + L+ K +GS Sbjct: 104 QCQKCFQAGHWTYECKNERVYISRPSRTQQLKNPKLRTKPSVDDLDGS 151 >UniRef50_UPI0000587099 Cluster: PREDICTED: similar to ZCCHC10 protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ZCCHC10 protein - Strongylocentrotus purpuratus Length = 117 Score = 49.6 bits (113), Expect = 1e-04 Identities = 21/46 (45%), Positives = 31/46 (67%) Frame = +3 Query: 129 GHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCSNGSCKIPNKK 266 GHW+YEC GKRK + RPSR ++K LK K++ + G+ ++ N K Sbjct: 2 GHWTYECSGKRKYVHRPSRISTLNKKLKQKQKEE-EEGAKRLENPK 46 >UniRef50_A0E2U0 Cluster: Chromosome undetermined scaffold_75, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_75, whole genome shotgun sequence - Paramecium tetraurelia Length = 167 Score = 47.2 bits (107), Expect = 6e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +3 Query: 102 IRCQKCLEFGHWSYECKGKRKILVRPSRT 188 +RCQ+CL++GH +YECK + L RPSRT Sbjct: 35 VRCQRCLKYGHLTYECKNENVYLYRPSRT 63 >UniRef50_Q55V50 Cluster: Putative uncharacterized protein; n=1; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 217 Score = 47.2 bits (107), Expect = 6e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +3 Query: 105 RCQKCLEFGHWSYECKGKRKILVRPSRTR 191 RCQKCL+FGH++Y+CK + RPSRT+ Sbjct: 20 RCQKCLKFGHYTYQCKNPMPYVPRPSRTK 48 >UniRef50_UPI00006CB052 Cluster: hypothetical protein TTHERM_00239330; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00239330 - Tetrahymena thermophila SB210 Length = 364 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/42 (42%), Positives = 29/42 (69%) Frame = +3 Query: 96 QGIRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKE 221 + RCQKCL+ GH++YEC+ + + RPS T + +KN + K+ Sbjct: 22 ENYRCQKCLKLGHFTYECQNQAAYVYRPSAT-MQYKNQELKQ 62 >UniRef50_Q0US55 Cluster: Putative uncharacterized protein; n=2; Pezizomycotina|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 342 Score = 41.9 bits (94), Expect = 0.022 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 4/41 (9%) Frame = +3 Query: 108 CQKCLEFGHWSYECKG---KRKILVRPSRT-RIMHKNLKAK 218 CQKCL+ GH+SYECK +R RPSRT ++++ LK K Sbjct: 18 CQKCLKRGHYSYECKATAQERPYQSRPSRTQQLLNPKLKPK 58 >UniRef50_A2QQ15 Cluster: Similarity: the predicted ORF may be N-terminally too short; n=5; Trichocomaceae|Rep: Similarity: the predicted ORF may be N-terminally too short - Aspergillus niger Length = 301 Score = 37.9 bits (84), Expect = 0.36 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 3/31 (9%) Frame = +3 Query: 108 CQKCLEFGHWSYEC---KGKRKILVRPSRTR 191 CQKCL+ GH+SYEC +R + RPSRT+ Sbjct: 22 CQKCLKRGHYSYECTVTAQERPYMSRPSRTQ 52 >UniRef50_Q5NRP7 Cluster: Putative gag-pol polyprotein, identical; n=2; Solanum demissum|Rep: Putative gag-pol polyprotein, identical - Solanum demissum (Wild potato) Length = 1588 Score = 37.1 bits (82), Expect = 0.63 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 102 IRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQ 230 I+C KC GH +EC +R IL+R + K+ + +EEG+ Sbjct: 342 IQCHKCHGRGHMMHECPSRRNILLRENGEYESEKSEREEEEGE 384 >UniRef50_Q868S9 Cluster: Gag-like protein; n=1; Anopheles gambiae|Rep: Gag-like protein - Anopheles gambiae (African malaria mosquito) Length = 724 Score = 35.1 bits (77), Expect = 2.5 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +3 Query: 102 IRCQKCLEFGHWSYECK 152 +RC +CLE GHW+++C+ Sbjct: 660 VRCYRCLELGHWAHDCR 676 >UniRef50_Q8MY21 Cluster: Gag-like protein; n=2; Forficula scudderi|Rep: Gag-like protein - Forficula scudderi Length = 148 Score = 33.9 bits (74), Expect = 5.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 105 RCQKCLEFGHWSYECKGKRK 164 +C KC FGH SYEC+G + Sbjct: 66 KCYKCQNFGHMSYECEGNNE 85 >UniRef50_Q4D9Y6 Cluster: Putative uncharacterized protein; n=1; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 158 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +3 Query: 108 CQKCLEFGHWSYECK----GKRKILVRPSRTRIMHKNLKAKEE 224 CQKC HW++EC+ RK R SR++++ +K + + Sbjct: 27 CQKCASTEHWTFECQNAADATRKTTARLSRSQMLRWGIKRRRQ 69 >UniRef50_Q4Z4M7 Cluster: Putative uncharacterized protein; n=2; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 418 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/43 (32%), Positives = 28/43 (65%) Frame = +2 Query: 497 VLNLMLVYYCLV*FLFSTNLYFQNFYFLISLFPN*FYLSFLQI 625 ++ L++ ++C F+F N Y+ NF+FL++LF ++S L + Sbjct: 362 IIKLIIYFFCF--FIFEKN-YYINFFFLVALFSINIFISLLYL 401 >UniRef50_Q24362 Cluster: Putative ORF1; n=2; melanogaster subgroup|Rep: Putative ORF1 - Drosophila melanogaster (Fruit fly) Length = 426 Score = 33.5 bits (73), Expect = 7.7 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 93 PQGIRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCSN 239 P +RC+KCL FGH + CK + + S T+ + K E C N Sbjct: 183 PLPLRCKKCLRFGHPTPICKSV-ETCINCSETKHTNDGEKCTNEKNCLN 230 >UniRef50_Q241W0 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1274 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 444 TFSCLNRCQIQNHCCSLNQTRSPIHCCCHYQTSSNPPMTN 325 TFSC+N C + + NQT P H C QT P T+ Sbjct: 502 TFSCVNTCNTNQYKNTQNQTCQPCHISC--QTCKGPDNTD 539 >UniRef50_A7RK63 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 85 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -1 Query: 267 FSCWVSCSCHCCIDLLLWLSDSYA*FVYVKDELGSCVCPCTHSSSVQTPSTSGILCL 97 F C V CSCHC + + + YV D L C C+ S+V+ S CL Sbjct: 30 FRCNVDCSCHCNVACSCHCNVECSCPCYV-DCLSHCYVDCSRHSNVECSSYCNFKCL 85 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 519,901,812 Number of Sequences: 1657284 Number of extensions: 8894761 Number of successful extensions: 24554 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 23135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24499 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 84031265255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -