BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_P01 (918 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49400.1 68418.m06113 zinc knuckle (CCHC-type) family protein... 50 2e-06 At3g42860.1 68416.m04491 zinc knuckle (CCHC-type) family protein... 28 7.5 >At5g49400.1 68418.m06113 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 275 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +3 Query: 105 RCQKCLEFGHWSYECKGKRKILVRPSRT-RIMHKNLKAKEEGQCSNGS 245 +CQKC + GHW+YECK +R + RPSRT ++ + L+ K +GS Sbjct: 99 QCQKCFQAGHWTYECKNERVYISRPSRTQQLKNPKLRTKPSVDDLDGS 146 >At3g42860.1 68416.m04491 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 372 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 108 CQKCLEFGHWSYECKGK 158 C KC + GHWS +C G+ Sbjct: 306 CYKCGKQGHWSRDCTGQ 322 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,490,161 Number of Sequences: 28952 Number of extensions: 199504 Number of successful extensions: 522 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -