BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O22 (913 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0127 + 12140843-12140966,12141170-12141567 44 2e-04 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 41 0.002 02_05_0686 - 30900748-30902167,30903442-30904742 40 0.003 11_06_0610 - 25449085-25453284 38 0.008 06_02_0126 + 12130409-12130532,12131015-12131373 38 0.008 12_02_1174 - 26696869-26698191 36 0.034 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 36 0.034 07_03_0177 - 14770777-14772045 36 0.034 03_01_0515 - 3864796-3865425 36 0.034 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 36 0.034 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 36 0.045 12_02_0299 - 17051570-17052474,17053542-17053755 35 0.078 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 35 0.078 08_02_0743 - 20647440-20647927,20647997-20648426,20650127-206505... 34 0.14 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 34 0.18 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 34 0.18 08_01_0059 - 394001-394708 33 0.24 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 33 0.24 11_01_0066 - 536281-537196,537397-537452 33 0.31 07_03_0558 + 19461369-19462448 33 0.31 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 33 0.42 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 33 0.42 01_05_0490 + 22672241-22674679 33 0.42 08_02_1084 - 24232968-24234779 32 0.55 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 32 0.55 06_03_1326 - 29355467-29355817 32 0.55 03_02_0765 + 11000724-11002496 32 0.55 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 32 0.73 07_03_0559 + 19475893-19476783 32 0.73 02_04_0400 - 22608519-22608844,22609044-22609122 32 0.73 01_01_0070 - 542603-542686,542803-543441 32 0.73 07_03_0560 + 19479597-19480667 31 0.96 07_01_0862 - 7172083-7172931 31 0.96 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 31 0.96 07_01_0080 + 587674-588510 31 0.96 07_03_0890 - 22332768-22333382 31 1.3 07_01_0479 + 3606663-3607448 31 1.3 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 31 1.3 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 31 1.3 06_01_0486 - 3455030-3455770 31 1.7 02_01_0158 - 1103461-1104186 31 1.7 01_01_0570 - 4231100-4232560 31 1.7 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 30 2.2 06_03_0790 - 24636805-24637770 30 2.2 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 30 2.2 05_03_0040 - 7646525-7647775 30 2.2 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 30 2.2 03_01_0023 + 198414-198968 30 2.2 02_02_0338 + 9105725-9106581,9106950-9107091 30 2.2 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 30 2.2 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 30 2.9 07_03_1751 - 29215074-29216270 30 2.9 06_02_0125 + 12122812-12122911,12123647-12123993 30 2.9 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 30 2.9 04_03_0904 + 20717005-20718087 30 2.9 12_02_1219 + 27096477-27096590,27096704-27097078 29 3.9 10_08_0216 - 15942379-15942852,15942956-15943033 29 3.9 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 3.9 06_03_1506 + 30641428-30642168 29 3.9 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 3.9 02_05_0149 + 26290236-26290880 29 3.9 12_01_0841 - 7873458-7874225 29 5.1 10_05_0028 - 8311041-8311709,8312175-8312478,8314768-8314841 29 5.1 07_03_1636 + 28290642-28291574 29 5.1 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 5.1 07_01_0037 + 301864-302349 29 5.1 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 29 5.1 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 29 5.1 04_04_1125 + 31085106-31085714 29 5.1 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 29 5.1 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 29 5.1 03_02_0738 - 10824121-10825572 29 5.1 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 29 5.1 02_04_0028 + 19027510-19027983,19028087-19028278,19028369-190285... 29 5.1 01_01_0796 + 6190931-6192745 29 5.1 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 29 6.8 11_01_0385 + 2915532-2916482 29 6.8 10_08_0214 - 15915156-15915713 29 6.8 10_08_0213 - 15912048-15912716 29 6.8 06_01_0178 + 1386981-1387505 29 6.8 04_04_0679 + 27214577-27215023 29 6.8 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 6.8 12_01_0838 - 7830944-7831444 28 9.0 12_01_0135 + 1042889-1044255,1045368-1045809 28 9.0 11_01_0133 + 1121392-1122731,1123417-1123858 28 9.0 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 28 9.0 09_04_0506 - 18188785-18190599 28 9.0 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 28 9.0 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 28 9.0 07_03_1432 - 26508135-26508881,26509301-26509708 28 9.0 06_02_0122 - 12095385-12095713,12096018-12096120 28 9.0 03_02_0342 - 7645323-7645909,7646323-7646491 28 9.0 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 28 9.0 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 28 9.0 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 28 9.0 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/56 (37%), Positives = 25/56 (44%) Frame = -1 Query: 703 GGF*XFGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXGGPXXXGGGXFXGGXGGFW 536 GG+ +GG GG + K GGG G GG GGG + GG GG W Sbjct: 117 GGYGGYGGYGGGGYGGYNKGYGGGGGGGYSKGFGGGYGGGGYPGGGYYGGGGGGGW 172 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/55 (30%), Positives = 22/55 (40%) Frame = -1 Query: 703 GGF*XFGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXGGPXXXGGGXFXGGXGGF 539 GG+ +GG GG GGG + + G GG G GG GG+ Sbjct: 91 GGYGGYGGGYGGGYGGGGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGGGGY 145 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G + GG G + G GGGG G G +G Sbjct: 71 GGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGGGGYGGYG 120 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G + G GGGG G G +G Sbjct: 98 GGYGGGYGGGGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGGGGYSKGFGGGYG 154 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = +2 Query: 524 GGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPP----XAPKX 691 G P P P PPPP P P P + PPP P PPP P+ Sbjct: 260 GSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRS 319 Query: 692 LKXPP 706 + PP Sbjct: 320 IPPPP 324 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 492 PPXXXFXXKKGGXXXQXPPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXP 671 PP G PP P PPP PP P PPP + P Sbjct: 250 PPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQ---PP 306 Query: 672 PXXPPXF*XPP 704 P PP PP Sbjct: 307 PPPPPLANGPP 317 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +1 Query: 493 PPXXXFXKKKGGXXPKXPXXPXKXTPPPXXGXPXXLXXKXXFXXKXXPPPXFXKKXPXPP 672 PP G P P P PPP P + PPP + P PP Sbjct: 250 PPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPP 309 Query: 673 P 675 P Sbjct: 310 P 310 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +2 Query: 515 KKRGGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXL 694 K P P PPPP G P P K P PPP P PPP K Sbjct: 320 KPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPP---PPPPKGPSPPPPPPPGGKKGG 376 Query: 695 KXPP 706 PP Sbjct: 377 PPPP 380 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPP 676 P P PPPP G P P K P PPP K P PPP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSP-PPPPPPGGKKGGPPPPP 381 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PPPP P P P K PPP K P PPP PK PP Sbjct: 318 PPKPAAAAPPPPPPPKAAPPPP------PPKGPPPPPPAKGPPPPPP--PKGPSPPP 366 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 PPPP P P K PPP K P PPP PP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P PPPP P P K PPP K PP AP Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAP 393 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 5/62 (8%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXP-XXXKXFXPLKXXPPPXFXKXXP----XPPPXAPKXLKX 700 P P P PPPP P P P+K PPP P PPP AP L Sbjct: 1135 PLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPP 1194 Query: 701 PP 706 PP Sbjct: 1195 PP 1196 Score = 35.1 bits (77), Expect = 0.078 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXP-----XPPPXAPKXLKXPP 706 P P PPPP P P P PPP P PPP AP L PP Sbjct: 1170 PPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPP 1228 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXX-KXFXPLKXXPPPXFXKXXP----XPPPXAPKXLKXPP 706 P P PPPP P P P+K PPP P PPP AP PP Sbjct: 1154 PPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1212 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXX-KXFXPLKXXPPPXFXKXXP----XPPPXAPKXLKXPP 706 P P PPPP P P P+K PPP P PPP AP PP Sbjct: 1186 PPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1244 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P PPPP P P P PPP P PP +P Sbjct: 1202 PPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSP 1248 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXP-----PPXAPKXLKXPP 706 P P PPPP P P P + PPP P PP AP L PP Sbjct: 1218 PPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPP 1276 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PPPP P K P + PP + PPP + PP Sbjct: 651 PPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPP 707 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PPPP P K P++ PP + PPP PP Sbjct: 684 PPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPP 740 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXP-----PPXAPKXLKXP 703 P P PPPP P P P+ PP P P PP AP L P Sbjct: 1266 PPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPP 1323 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXP-LKXXPPPXFXKXXP----XPPPXAPKXLKXPP 706 P P PP P P P +K PPP P PPP AP L PP Sbjct: 1106 PSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPP 1164 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PPPP P + P + PP K PPP PP Sbjct: 618 PPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPP 674 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P P P K PPP + P PP P K PP Sbjct: 566 PPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPP 619 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P P P P PP + P PP +P K PP Sbjct: 729 PPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPP 782 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +2 Query: 518 KRGGXXPKXPXXPX-KXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXL 694 K G + P P K PPP P K P + PP K PPP Sbjct: 578 KSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHT 637 Query: 695 KXPP 706 PP Sbjct: 638 PSPP 641 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPP---PXAPKXLKXPP 706 P PPP P P P + PPP P PP P P + PP Sbjct: 1122 PPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPP 1178 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPPXF*XPP 704 PP P+ PPP PP P PPP P PP PP Sbjct: 541 PPATPESSPPPEGKSPPTPTAS------HSPPPVPEGHTPSPPKSGPPAGESPP 588 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/60 (28%), Positives = 19/60 (31%), Gaps = 6/60 (10%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXP------PPXAPKXLKXPP 706 P P K PPPP P + P + PP P PP P PP Sbjct: 867 PPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPP 926 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/56 (35%), Positives = 25/56 (44%) Frame = -1 Query: 703 GGF*XFGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXGGPXXXGGGXFXGGXGGFW 536 GG+ +GG GG + + GGG G GG GGG + GG GG W Sbjct: 111 GGYGGYGGYGGGGYEGYGRGYGGGG-------GGGGYGGGGYPGGGYYGGGGGGGW 159 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXF-----XGKXXFXXXGXGXPXXGGGGXFXG 553 GG G GGG G + GGG + G + G G GGGG + G Sbjct: 87 GGYGGGYGGYGGGYGGGYGGGGGGGGYGGYGGYGGGGYEGYGRGYGGGGGGGGYGG 142 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G + GG G + G GGGG G G +G Sbjct: 71 GGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGYGGYGGYG 120 >12_02_1174 - 26696869-26698191 Length = 440 Score = 36.3 bits (80), Expect = 0.034 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKX--FXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P P PPPP P P K P PP P PPP P +K P Sbjct: 150 PSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPP 204 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 539 KXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 K P K PPP P P P PP K P PPP P PP Sbjct: 171 KPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPK--PQPPPTLPPPSPPPP 224 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPX---APKXLKXP 703 P PPPP P+K PPP P PPP P +K P Sbjct: 121 PVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPP 173 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPP 676 P PPPP P P K PPP P PPP Sbjct: 183 PSLQPPSPPPPPPTRPPSVKPPVVQP-KPQPPPTLPPPSPPPPP 225 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P K PPP P P P P + P PPP PP Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPP 193 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 PK P PPP P P K PPP P PPP P Sbjct: 263 PKPSPPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPP----PSPPPPPQQP 308 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 36.3 bits (80), Expect = 0.034 Identities = 19/57 (33%), Positives = 23/57 (40%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG + G GGG G GG + G G G GGGG + G G +G Sbjct: 118 GGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQGGGGGYGGNNGGYG 174 >07_03_0177 - 14770777-14772045 Length = 422 Score = 36.3 bits (80), Expect = 0.034 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXF---XGXXGXFG 535 GG K G GGG G GGG F G G G GGGG F G G FG Sbjct: 59 GGYGKGGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGKGGGVGGGFG 118 Score = 35.9 bits (79), Expect = 0.045 Identities = 23/57 (40%), Positives = 24/57 (42%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG + G GGG G GGG F G F G G GGGG G G FG Sbjct: 58 GGGYGKGGGFGGGGG-----GGGGGGFGGGGGFGGGGGGGLGGGGGGGL-GGGGGFG 108 Score = 31.9 bits (69), Expect = 0.73 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G GGG G F G G GG F G G FG Sbjct: 76 GGGFGGGGGFGGGGGGGLG-GGGGGGLGGGGGFGKGGGVGGGFGKGGGF-GKGGGFG 130 Score = 31.9 bits (69), Expect = 0.73 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -2 Query: 687 LGAXGGGXGXFFXKXGG---GXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 LG GGG G F GG G F GK G G GGGG G G G Sbjct: 367 LGGGGGGGGGGFGGGGGSGIGGGF-GKGGGFGFGVGGGGFGGGGGGGGGGGGIG 419 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPX--XGGGGXFXGXXG 544 GG GGG G F K GG GK G G GGGG F G G Sbjct: 328 GGGLGGSFGKGGGLGGGFGKGGGIGGGFGKGGGLGGGGGLGGGGGGGGGGFGGGGG 383 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GG G G G FG Sbjct: 208 GGGIGKGGGLGGGFGKGGGLGGGGGLGGGGGLGGGIGKGGGLGGGIGKGGGLGGGFG 264 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G + GG GK G G GGG G G G Sbjct: 260 GGGFGKGGGLGGGGGLGGGEDGGLGGGIGKGGGIGGGFGKGGGLGGGGGLGGGGGLG 316 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -2 Query: 675 GGGXGXFFXKXGGGXXFXGKXXFXXXGXG-XPXXGGGGXFXGXXGXFG 535 GGG G F K GG GK G G GGGG G G G Sbjct: 328 GGGLGGSFGKGGGLGGGFGKGGGIGGGFGKGGGLGGGGGLGGGGGGGG 375 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 675 GGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GGG G F K GGG G G G GGGG G G FG Sbjct: 348 GGGIGGGFGK-GGGLGGGGGLGGGGGGGGGGFGGGGG--SGIGGGFG 391 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG F G GGG G GGG F G G G GGG G G Sbjct: 352 GGGFGKGGGLGGGGGLGGGGGGGGGGFGGGGG---SGIGGGFGKGGGFGFGVGG 402 Score = 28.3 bits (60), Expect = 9.0 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G GGG G G G G G G G FG Sbjct: 294 GGGFGKGGGLGGGGGL----GGGGGLGGGSGLGGGIGKGGGLGGSFGKGGGLGGGFG 346 Score = 28.3 bits (60), Expect = 9.0 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXG 553 GG F G G G G F K GG G F G G GGGG G Sbjct: 375 GGGFG--GGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGG---GGGGGGIGG 420 >03_01_0515 - 3864796-3865425 Length = 209 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPP 676 P P PPPP P P P PPP K P PPP Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PPP P P P PP P PPP +P PP Sbjct: 68 PLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPP---PPPSPPPPSPVKSSPPP 118 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P PPP P P P PPP P PPP P Sbjct: 43 PTEASPPPLAPPPSVTSSPPPPAAGPLMP--PPPPPPSVTSSPPPPPLPP 90 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = +3 Query: 552 PPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKK---XXLXPPXXPPXF*XPP 704 PP PPP P P PPP L PP PP PP Sbjct: 48 PPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPP 101 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 6/53 (11%) Frame = +2 Query: 545 PXXPXKXPPPPXXG------XPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P PPPP G P P P PPP P PPP +P Sbjct: 54 PPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSP 106 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 G GGG G F+ GGG G G G GGGG G G Sbjct: 184 GGDGGGGGEFWTSGGGGLAIGGGGDGVGLGLGLDGGGGGGFTGGRGG 230 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 G GGG G F GGG G F G G G GG G G Sbjct: 315 GITGGGDGGFPGGGGGGFSGGGGGGFPGGGCGGITGGDGGGVVGVDG 361 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG G G G G GGG G+ G G GGGG G G Sbjct: 199 GGLAIGGGGDGVGLGLGLDGGGGGGFTGGRGGGLTGGGGEGNTGGGGGGGGNCG 252 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 35.9 bits (79), Expect = 0.045 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +2 Query: 515 KKRGGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPP-PXAPKX 691 K + G PK P K PP P P K K PP K P PP P P Sbjct: 171 KPKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPPQPWWPIP 230 Query: 692 LKXPP 706 PP Sbjct: 231 FPKPP 235 Score = 33.5 bits (73), Expect = 0.24 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +2 Query: 527 GXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 G P P PP P G P P K P K PP K P PP PK PP Sbjct: 156 GPKPGPKPKPKPSPPKPKPG-PKPKPPKP-GP-KPKPPKPGPKPKPKPPKPGPKPKPKPP 212 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 35.1 bits (77), Expect = 0.078 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPP-PXFXKXXPXPPPXAP 685 P PPPP P P PL PP P F P PPP P Sbjct: 286 PPSPPPPPPPAFPFP--FPQLPPLPHFPPLPSFYPSPPPPPPPPP 328 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXP 664 P P PPPP P P F P PP + + P Sbjct: 322 PPPPPPPPPPPSFPWPFPPLAPLFPPYPSPPPSMYSRKDP 361 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPP 676 P P PPPP P P F PL PP P PPP Sbjct: 312 PLPSFYPSPPPPPPPPPPPPPSFPWPFPPLAPLFPP-----YPSPPP 353 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +2 Query: 536 PKXPXXPXKXPP---PPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P PP P P P F P PPP P P P P PP Sbjct: 255 PPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPP--PPAFPFPFPQLPPLPHFPP 312 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 480 FXXXPPXXXFXXKKGGXXXQXPPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPP 641 F PP F PP PP PPP P P F PPP Sbjct: 301 FPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPPSFPW-PFPPLAPLFPPYPSPPP 353 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +2 Query: 545 PXXPXKXPP-PPXXGXPXPXXXKXFXPLKXXP----PPXFXKXXPXPPP 676 P P PP PP P P + P P PP F P PPP Sbjct: 245 PPIPFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPP 293 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 35.1 bits (77), Expect = 0.078 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXP-XPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P PP P P P P PPP P PPP P PP Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPP 1194 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P PP P P P + PL PP P PPP P Sbjct: 1123 PPLPDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATP 1169 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PPPP P P + PP P PPP L PP Sbjct: 1130 PPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPP 1183 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P PPPP P PL PPP + P P P P + PP Sbjct: 1159 PLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPP---QPAPPPLPIQPPPIPPPP 1212 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P PPPP P P PL PPP P P P +P L P Sbjct: 1174 PLSPSLPPPPPPPPLPSGPPPQPAP--PPLPIQPPP----IPPPPVPSSPSSLGYQP 1224 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P PP P P P PPP P P P ++ PP Sbjct: 1155 PCQPPLPPSPPPATPPPPPPLSPSLP-PPPPPPPLPSGPPPQPAPPPLPIQPPP 1207 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXF-XPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PP P P P PL PPP P PPP +P PP Sbjct: 1130 PPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPP---ATPPPPPPLSPSLPPPPP 1184 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +2 Query: 536 PKXPXXPXKXPPPP----XXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P PPPP P P P + PPP + P PPP P Sbjct: 1161 PPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVP 1214 >08_02_0743 - 20647440-20647927,20647997-20648426,20650127-20650570, 20650639-20650692 Length = 471 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 8/63 (12%) Frame = +2 Query: 518 KRGGXXPKXPXXPXKXPPPPXXGXPXP--------XXXKXFXPLKXXPPPXFXKXXPXPP 673 KRG P P P PPPP P P P PP K P PP Sbjct: 88 KRGRGRPPKPRDPNAPPPPPKPSSPRPRGRPPKSKDPISDAIPKSRGRPPKKAKTAPAPP 147 Query: 674 PXA 682 P A Sbjct: 148 PAA 150 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 PPPP G P P PPP PPP AP PP Sbjct: 423 PPPPPPGSYAPVPWGQPPPYASYPPPPPGSSMYNPPPPAPGQATPPP 469 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P PPPP P P P PPP K P P P + P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPPKATMARFP 398 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPP 686 PP PP PPP PP P KK PPP K P P Sbjct: 360 PPPPPPPPPPPPRPPPPPPPIKK-----GAPPPAPPKATMARFPKLSP 402 Score = 31.5 bits (68), Expect = 0.96 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPP 686 PP PP PPP PP P PPP KK PP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPR--------PPPPPPPIKKG--APPPAPP 390 >08_01_0059 - 394001-394708 Length = 235 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXP-XXKKXFXX*XXPPPXFXKKXXLXPPXXPPXF*XPP 704 PP PP++ PPP PP P PPP + PP P PP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 57 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKX--FXPLKXXPPPXFXKXXPXPP--PXAP 685 P P + PPPP P P P++ PPP P PP P AP Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAP 54 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 PPPP P P + PPP P PPP P+ PP Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRP-PPPPTPRPYAPPP 47 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +2 Query: 539 KXPXXPXKXPPPPXXGXPXPXXX----KXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 + P P PPPP P P P PPP P PP +P PP Sbjct: 9 RAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPP 68 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXX--GXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P P + PPPP P P PL PPP P PPP +P Sbjct: 25 PPPPSPPIRPPPPPTPRPYAPPPPS----HPL-APPPPHISPPAPVPPPPSP 71 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +3 Query: 543 PPXPPKKXPPPXXX--GPPXPXXKKXF------XX*XXPPPXFXKKXXLXPPXXPP 686 PP PP++ PPP PP P + + PPP + PP PP Sbjct: 17 PPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSPP 72 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P + PPP P P P PP P PP L PP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPP 56 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = -1 Query: 703 GGF*XFGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXGGPXXXGGGXFXGGXGGFWXXXP 524 GG +GG GG GGG + G GG GGG GG G W Sbjct: 73 GGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGGGRGGGRDGDWVCPD 132 Query: 523 P 521 P Sbjct: 133 P 133 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G + GGG G + G G GGGG G G G Sbjct: 69 GGYGGGGGGYGGGGGGY---GGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGGGRGG 122 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG + G GG G GGG + G G G GGGG G G Sbjct: 59 GGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGG 112 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFX-GKXXFXXXGXGXPXXGGGGXFXGXXG 544 G GGG G + GGG + G F G G GGG G G Sbjct: 200 GGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRG 247 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -2 Query: 687 LGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXG 553 +G GGG G GGG G G G GGGG + G Sbjct: 43 VGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGG 87 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 58 GGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGG 114 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = -2 Query: 705 GGXFKXLGAXGGGX---GXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGG 568 GG + G GGG G F GGG G + G G GGG Sbjct: 206 GGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGGGTGGGG 254 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG G GGG G + GGG G G G GGGG + G G Sbjct: 54 GGGGGGGGYGGGGVGGGYGGGGGGYGGGG----GGYGGGGRGGGGGGGYGGGGG 103 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 688 FGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXGGPXXXGGGXFXGGXG 545 F G GG R GGG + G GG GGG GG G Sbjct: 42 FVGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGG 89 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/62 (30%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPP-----PXFXKXXPXPPPXAPKXLKX 700 P P P PPPP P P P PP P + P PPP ++ Sbjct: 206 PPRPLPPAS-PPPPSIATPPPSPASPPPPSTATPPPPSPTPTTTRASPTPPPIPTATVRP 264 Query: 701 PP 706 PP Sbjct: 265 PP 266 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/53 (26%), Positives = 15/53 (28%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P PPPP P P PP PPP P+ P Sbjct: 223 PPPSPASPPPPSTATPPPPSPTPTTTRASPTPPPIPTATVRPPPPLPRATVTP 275 >07_03_0558 + 19461369-19462448 Length = 359 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G F GGG G G G GGGG G G FG Sbjct: 64 GGLGGGGGGLGGGHGGGFG--GGGGLGGGASGGVGGGGGFGGGGGGGLGGGQGGGFG 118 Score = 31.5 bits (68), Expect = 0.96 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = -2 Query: 705 GGXFKXLGAXG--GGXGXFFXKXGG-GXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG F G G GG G F GG G G F G G G GG F G G Sbjct: 208 GGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGGGLGGGHGGGFGGGAG 264 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G GGG G G G G G G G FG Sbjct: 224 GGGFGAGGGAGGGIGGGGGFGGGGGGGLGGGHGGGFGGGAGVGSGAGGGVGGGGGFG 280 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG LG GG G F GG G G G GGGG G G FG Sbjct: 139 GGGGGGLGGGGGHGGGF---GAGGGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFG 192 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGG-GXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G G F G G G GG F G G G Sbjct: 142 GGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGGGAGVGG 199 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G G G G GG G G G GGGG G G FG Sbjct: 276 GGGFGGGGGGGLGGGHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFG 332 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GG G G G FG Sbjct: 296 GGGAGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGAGAGVGGGAGGGVGGGGGFG 352 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G G G GGGG G G G Sbjct: 128 GGGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLG 184 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G GGG G G G GG G G G FG Sbjct: 163 GGAGGGVGGGGGFGGGGGGGLGGGHGGGFGGGAGVGGGAGGGVGGGGGFG 212 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F GGG G GG G G G GG G G G FG Sbjct: 188 GGGFGGGAGVGGGAGGGVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFG 244 Score = 29.5 bits (63), Expect = 3.9 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -2 Query: 705 GGXFKXLGAXGG--GXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GG G G F GGG G G G GG G G G FG Sbjct: 118 GGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFG 176 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 705 GGXFKXLGAXGG-GXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG GA GG G G F GGG G+ G G GG G G G FG Sbjct: 83 GGGGLGGGASGGVGGGGGFGGGGGGGLGGGQGG--GFGGGAGAGGGAGGGLGGGGGFG 138 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G F GGG G G G GGGG G G G Sbjct: 107 GGLGGGQGGGF---GGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGGGHGG 153 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -2 Query: 705 GGXFKXLGAXGG-GXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG GA GG G G F GGG G G G GG G G G FG Sbjct: 261 GGAGVGSGAGGGVGGGGGFGGGGGGGLGGGHGS--GFGGGAGVGGGAGGGVGGGGGFG 316 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 703 GGF*XFGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXGGPXXXGGGXFXGGXGGF 539 GG GG GG GGG G GG GGG GG GGF Sbjct: 307 GGVGGGGGFGGGGGGGLGGGHGGGF--GAGAGVGGGAGGGVGGGGGFGGGGGGGF 359 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G GGG G G G GG G G G G Sbjct: 152 GGGFGAGGGVGGGAGG--GVGGGGGFGGGGGGGLGGGHGGGFGGGAGVGGGAGGGVG 206 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -2 Query: 705 GGXFKXLGAXGG-GXGXFFXKXGGGXXFXGKXX-FXXXGXGXPXXGGGGXFXGXXG 544 GG GA GG G G F GG G+ F G GGGG F G G Sbjct: 193 GGAGVGGGAGGGVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGG 248 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -2 Query: 675 GGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GGG G + GG G G G GGGG G G FG Sbjct: 214 GGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGGGLGGGHGGGFG 260 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P P + PPP P P PPP PPP AP Sbjct: 607 PPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAP 656 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXL 694 PPPP P P P PPP PPP P L Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPL 627 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P PPPP P P PPP P PPP P Sbjct: 564 PPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP 607 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P P PP P P P PPP PPP P Sbjct: 590 PPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPP 639 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 569 PPPXXGXPXPXXXKXFXPLKXXPPPXFX-KXXPXPPPXAPKXLKXP 703 P P P P P PPP K P PPP P+ K P Sbjct: 730 PAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKPP 775 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/61 (27%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = +2 Query: 515 KKRGGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPP----XFXKXXPXPPPXA 682 +K P P PPPP P P PPP + P PPP Sbjct: 532 RKLPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPP 591 Query: 683 P 685 P Sbjct: 592 P 592 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = +2 Query: 554 PXKXPPPP-----XXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P PPPP P P P + PPP P PPP P PP Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPP------PPPPPPLPNHSVLPP 635 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +3 Query: 492 PPXXXFXXKKGGXXXQXPPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXP 671 PP G P PP PPP PP P PPP L P Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPPP----PPLPQSNYASSQPPPPPPPPPLPNCLVP 600 Query: 672 PXXPP 686 PP Sbjct: 601 SPPPP 605 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/60 (31%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +2 Query: 524 GGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXP--XPPPXAPKXLK 697 GG + P PPPP P P + P PPP P PPP +P L+ Sbjct: 954 GGSAQQSEKRPPPPPPPPNVA-PPPFTRQDIPPPPPSPPPLPITQPPSVPPPPNSPPPLQ 1012 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P P PPP P PL PP PPP P Sbjct: 964 PPPPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPPPPNSPPPLQP 1013 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 522 GGXXXQXPPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPPXF*XP 701 GG Q PP PPP PP PPP PP PP P Sbjct: 954 GGSAQQSEKRPPPPPPPPNVAPPPFTRQDI-----PPPPPSPPPLPITQPPSVPPPPNSP 1008 Query: 702 P 704 P Sbjct: 1009 P 1009 >01_05_0490 + 22672241-22674679 Length = 812 Score = 32.7 bits (71), Expect = 0.42 Identities = 20/67 (29%), Positives = 25/67 (37%), Gaps = 4/67 (5%) Frame = +2 Query: 518 KRGGXXPKXPXXPXKXPPPPXXGXPX--PXXXKXFX--PLKXXPPPXFXKXXPXPPPXAP 685 +R P+ P P PPPP P P + PL PP P PPP + Sbjct: 650 RRSRKPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPPPPMSE 709 Query: 686 KXLKXPP 706 + PP Sbjct: 710 GEEEAPP 716 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/64 (25%), Positives = 20/64 (31%) Frame = +1 Query: 493 PPXXXFXKKKGGXXPKXPXXPXKXTPPPXXGXPXXLXXKXXFXXKXXPPPXFXKKXPXPP 672 PP ++ P+ P P PPP P + PP P PP Sbjct: 642 PPPPPPTTRRSRKPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPP 701 Query: 673 PXXP 684 P P Sbjct: 702 PPPP 705 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +3 Query: 492 PPXXXFXXKKGGXXXQXPPXPPKKXPPPXXXGPP-XPXXKKXFXX*XXPPPXFXKKXXLX 668 PP ++ Q P P PPP PP P + PPP L Sbjct: 642 PPPPPPTTRRSRKPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPP----SPPLP 697 Query: 669 PPXXPP 686 PP PP Sbjct: 698 PPPPPP 703 >08_02_1084 - 24232968-24234779 Length = 603 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXP-XPPPXAPKXLKXPP 706 PPPP P P K P P P P PPP AP L PP Sbjct: 95 PPPPLPQAPPPQQQKVHIPGVAAPAPNHPPSQPNLPPPAAPAPL--PP 140 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 32.3 bits (70), Expect = 0.55 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 524 GGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 G P P PPP P PLK P P P PPP APK P Sbjct: 546 GSLSESTPMQPPVMPPPIPKLLSPPAPQAPMPPLKASPVP---PPEPSPPP-APKAAPPP 601 Query: 704 P 706 P Sbjct: 602 P 602 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/56 (28%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXA--PKXLKXPP 706 P P PP P P + PPP P PPP + P + PP Sbjct: 561 PPIPKLLSPPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPP 616 >06_03_1326 - 29355467-29355817 Length = 116 Score = 32.3 bits (70), Expect = 0.55 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -2 Query: 687 LGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 +G GGG G K GGG GK G G GGGG G G G Sbjct: 1 MGGKGGGGGGG-GKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEG 50 >03_02_0765 + 11000724-11002496 Length = 590 Score = 32.3 bits (70), Expect = 0.55 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXG 553 GG F G GGG G F GGG G G G GGGG G Sbjct: 541 GGGFGAGGGAGGGAGAGF---GGGAGAGGGGGLGAGGGGGGGFGGGGGVGG 588 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G G G GGGG G G G Sbjct: 51 GGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGGGGAGGGFGGGLG 107 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG LG+ GG G GGG G G G GGGG G G G Sbjct: 188 GGAGGGLGSGAGGGGGLGGGAGGGGGLGGG---AGGGLGGGAGGGGGAGGGLGGGAG 241 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG LG GG G GGG G G G GGGG G G G Sbjct: 248 GGAGGGLGGGAGGGGGLSGGAGGGLG-GGAGAGGGGGLGGGTGGGGGLGGGTGGGGG 303 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 259 GGGGGLSGGAGGGLGGGAGAGGGGGLGGGTG--GGGGLGGGTGGGGGLGGGAGGGLG 313 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G GG G G G GGGG G G G Sbjct: 174 GGAGGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLG 223 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG GA GG G GGG G G G GGG G G FG Sbjct: 476 GGFGGGAGAGTGGGGGLGGGAGGGGGLGGGAG---GGLGGGAGAGGGFGGGKGGGFG 529 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F GGG G F GG G G G GGG G G G Sbjct: 99 GGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGGGLGGGAGGGLG 155 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G GG G G G GGGG G G G Sbjct: 224 GGAGGGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGGAGGGLG 273 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P + PPPP P + PPP P PPP AP PP Sbjct: 76 PPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPP-PPPPPSPPPSAPPPPPPPP 128 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = +3 Query: 543 PPXP----PKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPPXF*XPP 704 PP P P + PP GPP P PPP L PP PP PP Sbjct: 11 PPPPQGGFPPQPPPMNPYGPPPPQQPAYGHM---PPPQGAPPPFLAPPPPPPPGPPPP 65 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/55 (32%), Positives = 21/55 (38%) Frame = +2 Query: 521 RGGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 +GG P+ P PPPP P + PPP F P PPP P Sbjct: 15 QGGFPPQPPPMNPYGPPPPQQ-----PAYGHMPPPQGAPPP-FLAPPPPPPPGPP 63 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P PP P P + P PP P PPP P Sbjct: 74 PGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPP 113 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PPPP P P P PPP PPP P + PP Sbjct: 82 PPPPPQMYYQPPPP----PPPYGVNSSQPPPPPPPPP-SPPPSAPPPPPPPPTQPPP 133 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPP 673 PPPP P P P PPP + P PP Sbjct: 108 PPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXP 599 PP PP PPP PP P Sbjct: 108 PPPPPPPSPPPSAPPPPPP 126 >07_03_0559 + 19475893-19476783 Length = 296 Score = 31.9 bits (69), Expect = 0.73 Identities = 22/59 (37%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -2 Query: 705 GGXFKXLGAXG-GGXGXFFXKXGGGXXFXG-KXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F+ G G GG G F GGG G + G G GGG G G FG Sbjct: 70 GGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFG 128 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXX---GXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G F GGG G G G GGGG G G FG Sbjct: 153 GGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFG 212 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G GGG G G G GG G G G G Sbjct: 142 GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAG 198 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G K GG G G G GGGG F G G G Sbjct: 166 GGGFG--GGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGS-GGGGGFGGGGGKGG 219 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G F GG G G G GG G G G G Sbjct: 110 GGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGG 166 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G + GG G G G GGGG G G G Sbjct: 124 GGGFG--GGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGIG 178 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 642 GGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GGG F G F G G GGGG F G G Sbjct: 62 GGGGGFGGGGGFRGGGGG--GLGGGGGFGGGGG 92 Score = 28.3 bits (60), Expect = 9.0 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG +G GGG G F GG G G G GGGG G G G Sbjct: 129 GGSGGGVGG-GGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKG 184 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 31.9 bits (69), Expect = 0.73 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFGXXP 526 GG G GGG G GGG G+ G G GGGG G G G Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYY 94 Query: 525 P 523 P Sbjct: 95 P 95 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -1 Query: 703 GGF*XFGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXGGPXXXGGGXFXGGXGGFWXXXP 524 GG GG GG GGG G GG GGG GG GG P Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYP 95 Query: 523 PF 518 P+ Sbjct: 96 PW 97 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFGXXP 526 GG G GGG G GGG G G G GGGG + G G P Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNG--GYYP 103 Query: 525 P 523 P Sbjct: 104 P 104 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G GGG G G G GGGG G G G Sbjct: 32 GCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXP-XPPPXAPKXLKXPP 706 P P K PP P P P K PP P PPP PK PP Sbjct: 42 PTAPAKSPPAPATPAPTATPTPPVAPAK--APPVAPAVAPVTPPPPTPKKAPPPP 94 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P P K PPPP P P P PPP P PP P + P Sbjct: 84 PPTPKKAPPPPV--TPPPVTPPPVTPPPVSPPP--ATPPPALPPSTPPPVAAP 132 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +2 Query: 536 PKXPXXPXKXPP-PPXXGX--PXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P K PP P P P K P PPP PPP +P PP Sbjct: 61 PTPPVAPAKAPPVAPAVAPVTPPPPTPKKAPPPPVTPPP-VTPPPVTPPPVSPPPATPPP 119 >07_03_0560 + 19479597-19480667 Length = 356 Score = 31.5 bits (68), Expect = 0.96 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXG---KXXF-XXXGXGXPXXGGGGXFXGXXGXF 538 GG G GGG G F GGG G + F G G GGGG G G F Sbjct: 157 GGGSGTGGGLGGGGGGGFGGDGGGGLGGGGGKEGGFGAGGGVGGGAGGGGGMGGGGGGGF 216 Query: 537 G 535 G Sbjct: 217 G 217 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G GG G G G GGGG G G FG Sbjct: 213 GGGFGGGGGKGGGFGAGGGMGGGAG--GGGGLGGGGGGGMGGGGGGGMGGGAGGGFG 267 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG F G GGG G GGG G G G G GG F G G Sbjct: 223 GGGFGAGGGMGGGAGG-----GGGLGGGGGGGMGGGGGGGMGGGAGGGFGGGAG 271 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G G G F G G G GGGG G G G Sbjct: 84 GGGFGGGGGAGGGGG-LGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGG 139 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G F GG G G G GGGG G G G Sbjct: 256 GGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGGGAGGGLGGGAG 305 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G K GG G G G GGGG G G G Sbjct: 203 GGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGGGGGMG 259 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG F G GGG G GGG G G G GG G G G G Sbjct: 147 GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDGGGGLGGGGGKEGGFGAGGGVGGGAG 203 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 642 GGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GGG F G F G G GGGG F G G G Sbjct: 62 GGGGGFGGDGGFGGGGGG--GLGGGGGFGGGGGAGG 95 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -2 Query: 687 LGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGG--GXFXGXXGXFG 535 LG GG G F GGG G G G GGG G G G FG Sbjct: 99 LGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGGFG 151 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG LG GGG GGG G G GGGG F G G Sbjct: 126 GGGGGGLGGGGGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDGG 179 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G GGG G G GGGG G G G Sbjct: 249 GMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGGGAGG 298 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GG G G G G Sbjct: 115 GGGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGG 171 Score = 28.3 bits (60), Expect = 9.0 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXG--GGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G F G GG G G G GGGG G G G Sbjct: 199 GGGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGGGGG 257 >07_01_0862 - 7172083-7172931 Length = 282 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPP 674 PP PPKK P P PP P + P KK L PP Sbjct: 174 PPLPPKKKPLPPPSPPPQPPLPEKENTPLPPLLLPPKKKPLPPP 217 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPP 686 PP PP+K P P KK PPP KK L PP PP Sbjct: 148 PPLPPRKKAMLFPL--PLPPRKKPLLY---PPPLPPKKKPLPPPSPPP 190 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 7/61 (11%) Frame = +2 Query: 545 PXXPXKXPPPPXXGX-------PXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P P PPPP P P + L P P K PPP PK P Sbjct: 125 PAPPPPPPPPPPTAEEKKLLLFPPPLPPRKKAMLFPLPLPPRKKPLLYPPPLPPKKKPLP 184 Query: 704 P 706 P Sbjct: 185 P 185 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = -2 Query: 672 GGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G + GGG F G+ G G GGGG G G G Sbjct: 731 GGGGGRNRRSGGGARFGGRDFRRDRGSGGGGYGGGGGGYGGGGYGG 776 >07_01_0080 + 587674-588510 Length = 278 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXP 670 P PPPP G P P P PPP F + P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPPPLFTRRSHAP 130 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +3 Query: 525 GXXXQXPPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKK 656 G + PP PP PPP PP P PPP F ++ Sbjct: 86 GMFRRPPPPPP---PPPSSGSPPPPPPPPPPPPPPPPPPLFTRR 126 >07_03_0890 - 22332768-22333382 Length = 204 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPPXF 692 PP PP + PP PP P PPP PP P F Sbjct: 75 PPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPPELPSVF 124 >07_01_0479 + 3606663-3607448 Length = 261 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = +2 Query: 527 GXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 G P P P P P G P + + PPP P PPP P PP Sbjct: 192 GVPPAFPGGPPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMP-PPPFRPGMPPPPP 250 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +1 Query: 535 PKXPXXPXKXTPPPXXGX---PXXLXXKXXFXXKXXPPPXFXKKXPXPPPXXPQXFKXPP 705 P P P PPP P PPP F P PPP Q + PP Sbjct: 201 PPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGPQQPGQNPP 260 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/66 (33%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = +2 Query: 518 KRGGXXPKXPXXPXKXPPPPXX---GXPXPXXX-KXFXPLKXXPPPXFXKXXPXPPPXAP 685 K+ P P K PPP P P + P K PPP K P PPP P Sbjct: 187 KKEEPQPPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPPKKEPPPPPPPKQEPCPPP--P 244 Query: 686 KXLKXP 703 K ++ P Sbjct: 245 KVVEVP 250 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P P PP P P K K PPP PP AP+ PP Sbjct: 173 PPPPPAPEPEPEPPKKEEPQPPPPK--EEEKPEPPPAV--IIVEPPAPAPEPEPEPP 225 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P P + PPPP P P P PPP P PPP + P Sbjct: 420 PPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPP-----VPPPPPTTGSFMPIP 470 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 537 QXPPXPPKKXPPPXXXGPPXP 599 + PP PP+ PPP PP P Sbjct: 428 EQPPPPPEHPPPPESTSPPPP 448 >06_01_0486 - 3455030-3455770 Length = 246 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P P PPP P P P PPP P PP +P K P Sbjct: 107 PTPPYVPPYIPPPTPPYVPPPTPPS---PPPYVPPPTPPSPPPYVPPPSPPATKTCP 160 >02_01_0158 - 1103461-1104186 Length = 241 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGG 568 G GGG G F + GGG G+ G G GGG Sbjct: 83 GGGGGGGGGFGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 121 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXG 553 G K GGG G F GGG G + G GGGG G Sbjct: 75 GSFVKGGAGGGGGGGGGFGSRGGGGSGGGGRSYGGSWGGGRRSGGGGPGGG 125 >01_01_0570 - 4231100-4232560 Length = 486 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG + G GG G F GGG G+ G G GG G G G G Sbjct: 183 GGGGRFGGGGMGGGGGFGGGAGGGVGGGGELGGGGMGGGSGFGGGAGGGFGAGGGVG 239 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/57 (31%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G+ GG + GGG G F G G GG F G G G Sbjct: 124 GGVGAGFGSGGGVGAGGGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGG 180 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -2 Query: 705 GGXFKXLGAXG-GGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXG 553 GG + G G GG G F GGG F GGGG F G Sbjct: 139 GGGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGGGVGGGGRFGG 190 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG +G GG G GGG G G G GGGG G G FG Sbjct: 236 GGVGGGIGVGGGMGGGASGGIGGGAG-GGMGGDIGGGAGGGVGGGGGGGMGGGGGFG 291 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GG G GGG G G G GGG G G G Sbjct: 78 GTGGGAAGGLGGGGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVGGGVG 127 Score = 28.3 bits (60), Expect = 9.0 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G FG Sbjct: 105 GGGMGGSGGFGGGGGG---GVGGGVG-AGFGSGGGVGAGGGLRGGGGVGAGGGGGFG 157 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/56 (28%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXP--XPPPXAPKXLKXPP 706 P P PPPP P P+ PP P P P P+ + PP Sbjct: 405 PPPPLYYPPPPDISPSPPPSVTPLPPVVYPSPPEVTPSPPEIAPYPSPPEIVPSPP 460 >06_03_0790 - 24636805-24637770 Length = 321 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG G GGG G GGG G+ G G GGGG G G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GGG G G G GGGG G G G Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDG 153 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 642 GGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GGG F G+ G G GGGG + G G G Sbjct: 529 GGGNRFAGRDFRQGSGGGYSGGGGGGGYSGGGGGGG 564 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/57 (29%), Positives = 21/57 (36%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFGXXPPLFF 514 G GGG G + GGG G+ G GGGG G PP ++ Sbjct: 555 GYSGGGGGGGYSGGGGGYSGGGRGGGYSRGGRGGYSGGGGGGGGDPYRASAPPPRYY 611 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -2 Query: 675 GGGXGXFFXKXGGGXXFXGKXXFXXXGXGXP-XXGGGGXFXGXXGXFGXXP 526 GGG G + GGG G + G G GG G + G G G P Sbjct: 550 GGGGGGYSGGGGGGGYSGGGGGYSGGGRGGGYSRGGRGGYSGGGGGGGGDP 600 >05_03_0040 - 7646525-7647775 Length = 416 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 PK P P P P P P P K P P P AP PP Sbjct: 352 PKPQPEPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPKPKPEPKPEAPPKKHKPP 408 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P PPPP P P + PPP P P AP Sbjct: 49 PYPPPPPPMVAAPPPPPPQYAKHFAAGPPPAAAAGRRTPTPPAP 92 >03_01_0023 + 198414-198968 Length = 184 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG G GGG G GGG G G G GGGG G G Sbjct: 43 GGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGG 96 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G G G G G G GGGG G G G Sbjct: 36 GGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSG 92 >02_02_0338 + 9105725-9106581,9106950-9107091 Length = 332 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +2 Query: 560 KXPPPPXXGXPXPXXXKXFXPLKXXP--PPXFXKXXPXPPPXAPKXLKXPP 706 K PPPP P P P P K P PP + LK PP Sbjct: 4 KPPPPPTKPKPKPATAAQPAPAPATARTTPPLKKPPPLAPPTQARPLKPPP 54 >01_06_1731 + 39516897-39517632,39517744-39517912,39517985-39518488, 39518619-39518747,39519849-39519990,39520082-39520453 Length = 683 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 575 PXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P G P P PPP + P PPP P L PP Sbjct: 29 PAVGAPFPFQQLPHQLYCPQPPPPPYQVMPVPPPPPPVGLPVPP 72 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P P PP P PL PPP P PP P PP Sbjct: 24 PGMPPAVVPPSLPTTTPPAPTVVAPPLPTTPPPAVVAPSPPLPPLTPPPAIVPP 77 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG LG GG G GGG G G G G GG G G G Sbjct: 175 GGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAGGGAGGGGGLGG 231 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = -2 Query: 705 GGXFKXLGAX-GGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG GA GGG G GGG G G G GGGG G G G Sbjct: 143 GGAGGGAGAGVGGGAGAGGGAGGGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGGGAG 200 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXG--GGGXFXGXXGXFG 535 GG G GGG G F GGG G G G G GGG G G G Sbjct: 284 GGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGGGFGGGFGGGKGGGVGGGAG 342 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG F G G G G K GG G G G GGGG F G G Sbjct: 342 GGGFGGGGGAGAGGGFGGGKGGG----FGGGVGGGHGAGGGGAGGGGGFGGGAG 391 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G G G GGGG G G G Sbjct: 182 GGGSGGGGGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAGGGAGGGGGLGGGAGGGHG 238 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G G G GG G G G FG Sbjct: 238 GGGGGLGGGAGGGAGVGGGAGGGAGAGGGLGAGGGAGGGGGIGGGAGGGAGAGGGFG 294 Score = 28.7 bits (61), Expect = 6.8 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G F GG GK G G GGGG G G FG Sbjct: 308 GGGAGAGGGFGGGKGGGF----GGGFGGGKGGGVGGGAGGGFGGGGGA--GAGGGFG 358 Score = 28.3 bits (60), Expect = 9.0 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G G G GGGG G G FG Sbjct: 264 GGGLGAGGGAGGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGG--AGAGGGFG 318 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG G GG G G G GGG G G FG Sbjct: 270 GGGAGGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGGGFG 326 >06_02_0125 + 12122812-12122911,12123647-12123993 Length = 148 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGG 568 GA GGG G GGG G G G P GGG Sbjct: 55 GAHGGGYGYGGGYGGGGYGHPGYGGGYGGGYGHPGYGGG 93 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +3 Query: 543 PPXPP---KKXPPPXXXGPPXPXXKKXF 617 PP PP K PPP PP P KK F Sbjct: 1935 PPPPPVEGKPKPPPHAPPPPPPEAKKSF 1962 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P P P PP P P P K P P P P P P P Sbjct: 289 PYTPTPKPNPPPTYKPQPKPTPTPTPYKPQPKPTPSPYTPKPTPTPPTYTPTP 341 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +1 Query: 535 PKXPXXPXKXTPPPXXGXPXXLXXKXXFXXKXXPPPXFXKKXPXPPP-XXPQXFKXPP 705 PK P TP P P + PP + P PPP PQ PP Sbjct: 182 PKPTPTPYTPTPTPPSYKPQPKPTPTPYTPTPTPPSYKPQPKPNPPPTYKPQPKPNPP 239 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = -2 Query: 675 GGGXGXFFXKXGGGXXFXGKXXFXXXGXG------XPXXGGGGXFXGXXGXFG 535 GGG G + + GGG + G + G G GGGG + G G G Sbjct: 90 GGGGGGGYGQRGGGGGYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGG 142 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/59 (30%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = -2 Query: 705 GGXFKXLGAXGG--GXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG + G GG G G + GGG + + G GGGG + G G G Sbjct: 94 GGGYGQRGGGGGYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGGGYGGGYGSRG 152 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G + GGG G + G GGGG G G +G Sbjct: 80 GGGGGGGGGYGYGAGGGYGQAGGPYYGPYASG---GGGGGAGGGGGGGYG 126 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXP 599 PP PP+ PPP PP P Sbjct: 55 PPPPPRTLPPPPPPPPPQP 73 >06_03_1506 + 30641428-30642168 Length = 246 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/57 (29%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG G GGG + G G + G G GGGG + G G +G Sbjct: 175 GGGSGGGGGGGGGASGYRYGAGYGKGYGYGGGPGGGGGGAGGGGGGGSYNGGTGGYG 231 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P P PPPP P P K K PP P PPP P P Sbjct: 342 PVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPP-------PPPPPSVPSNNNLP 390 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 P P PPPP P P PPP P P P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEP 395 >02_05_0149 + 26290236-26290880 Length = 214 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G G G + G G G GGG + G G G Sbjct: 104 GGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGGRNYGGGSGGIG 153 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G GGG G GG G + G P GGGG G G +G Sbjct: 133 GGGGGGGGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGGGG--AGEGGGYG 180 >12_01_0841 - 7873458-7874225 Length = 255 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GA GGG G GGG G G G GGG G G G Sbjct: 176 GASGGGYGQGGGGGGGGGQGGGNGSGYGSGYGSGYGQGGGVHAGGYGQGG 225 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/56 (30%), Positives = 21/56 (37%) Frame = -2 Query: 702 GXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G + G GG G + + GGG G+ G G GGG G G G Sbjct: 53 GYGEGYGQGGGASGGGYGQGGGGGGGGGQGGGSGSGYGSGYGQGGGASGGGYGKGG 108 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 684 GAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GA GGG G GGG G G G GGG G G G Sbjct: 137 GASGGGYGQGGGGGGGGGQGGGNGSGYGSGYGSGYGQGGGASGGGYGQGG 186 >10_05_0028 - 8311041-8311709,8312175-8312478,8314768-8314841 Length = 348 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG + G GGG G GG + G+ + G G GG G G G Sbjct: 150 GGGYSGQGTYGGGGGY------GGGGYGGQDAYGGRGVGGYSEGGRGYVGGGYG 197 >07_03_1636 + 28290642-28291574 Length = 310 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P PPPP P P PPP P PP P L PP Sbjct: 149 PAPPPPPPQLFETAPPS-----PPYVPPPPDAYLRKPSPPSPPPAKLSPPP 194 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPP 593 PP PP PPP GPP Sbjct: 425 PPGPPPMLPPPFYPGPP 441 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPP 676 P P PPPP P PL PPP P PPP Sbjct: 221 PSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPP-----PPGPPP 262 >07_01_0037 + 301864-302349 Length = 161 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXG 553 GG GA GGG G GGG G G G GG G G Sbjct: 26 GGGVTSAGAAGGGGGGTRASGGGGEANAGGGCAIAGGGGCRGGGGCGMGMG 76 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/59 (28%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +2 Query: 536 PKXPXXPXKXPPPPXX---GXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P+ P + PPPP P P P PPP P P P P P Sbjct: 79 PRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAPPPTPTPKFPSSSANP 137 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = -2 Query: 702 GXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 G + G GGG G + GGG + G G GGG G G Sbjct: 60 GGGRGYGGGGGGGGRGYGGGGGGGGYESGGGRGYGGGGRGYESGGGRGPGGGG 112 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXG 544 GG G GGG G GGG G + G G GG G G G Sbjct: 61 GGRGYGGGGGGGGRGYGGGGGGGGYESGGGRGYGGGGRGYESGGGRGPGGGGRG 114 >04_04_1125 + 31085106-31085714 Length = 202 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +2 Query: 560 KXPPPPXX-GXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 K PPPP P P P PP P P P P PP Sbjct: 38 KPPPPPCQPPPPTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPP 87 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +2 Query: 524 GGXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPK 688 G P P P PPPP + PPP P PP APK Sbjct: 361 GNMRPPPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPP---TPPPPPPLLAPK 412 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXP 599 PP PP PPP PP P Sbjct: 49 PPRPPPPPPPPTQPAPPPP 67 >03_02_0738 - 10824121-10825572 Length = 483 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXP 599 PP PP PPP PP P Sbjct: 80 PPSPPSSSPPPLSFPPPPP 98 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPK 688 P + PPP P P + P F K P PPP PK Sbjct: 25 PSSEEQRAPPPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPPFPK 72 >02_04_0028 + 19027510-19027983,19028087-19028278,19028369-19028545, 19029568-19029663,19030487-19030618,19030950-19031008, 19031234-19031321,19031433-19031693 Length = 492 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 522 GGXXXQXPPXPPKKXPPPXXXGPPXPXXKK 611 GG PP PP+ PP PP P ++ Sbjct: 87 GGSAASRPPRPPRPPLPPRPPRPPLPPLRE 116 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 10/66 (15%) Frame = +2 Query: 515 KKRGGXXP-KXPXXPXKXPPPPXXGXPX-----PXXXKXFXP----LKXXPPPXFXKXXP 664 ++RGG P + P PPPP P P P L PPP P Sbjct: 179 RRRGGKRPIQGSSVPPPPPPPPPPPQPEQQLQLPQWPNLSGPHNQLLPVAPPPFVADQPP 238 Query: 665 XPPPXA 682 PPP A Sbjct: 239 PPPPPA 244 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -3 Query: 683 GXXGGGKGXFFXKXGGGXXLXXKXFFXXRXXGXPXXGGGVFFXG 552 G GGG+G F + GGG + R G P GGG F G Sbjct: 153 GGRGGGRGGFRGRGGGG----FRGRGAPRGRGGPPRGGGRGFRG 192 >11_01_0385 + 2915532-2916482 Length = 316 Score = 28.7 bits (61), Expect = 6.8 Identities = 22/96 (22%), Positives = 25/96 (26%), Gaps = 1/96 (1%) Frame = +1 Query: 421 FXXXPKKKXPXPXGGXKXXFXXXXPPXXXFXKKKGGXXPKXPXXPXKXTPPPXXGXPXXL 600 F P + P P PP + G P P P P P P Sbjct: 185 FNQPPTPEWPHPGNKWPPLPPFHPPPTPAWPHPGGNKWPPLPPFPSHPPPTPAWPQPGNK 244 Query: 601 XXK-XXFXXKXXPPPXFXKKXPXPPPXXPQXFKXPP 705 F P P + PP P F PP Sbjct: 245 WPPLPPFPSHPPPTPAWPHPGNQWPPLPPFPFHPPP 280 >10_08_0214 - 15915156-15915713 Length = 185 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/57 (28%), Positives = 21/57 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G + G GG G + + GGG G+ G G G G G G +G Sbjct: 56 GSGYGEGGGSGGAAGGGYGRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYG 112 >10_08_0213 - 15912048-15912716 Length = 222 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGG 565 GG G GGG G + G G F G G GGGG Sbjct: 76 GGGGGGGGGEGGGSGSGYGSGQGSGSGYGSGAFGAGGYGSGGGGGGG 122 >06_01_0178 + 1386981-1387505 Length = 174 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 GG GA GGG G GGG G G GGGG G G G Sbjct: 27 GGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKG 83 >04_04_0679 + 27214577-27215023 Length = 148 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 703 GGF*XFGGXXGGXRXXFXKXXGGGXF*XXKXFXXXGXG-GPXXXGGGXFXGGXGGFW 536 GG GG GG + GG F G G G GGG GG GG W Sbjct: 72 GGGGGGGGGVGGRGGSSGRGGHGGGFGWAGGQGHGGWGAGAGAFGGGSGSGGGGGGW 128 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +2 Query: 554 PXKXPPPPXXGX---PXPXXXKXFXPLKXXPPPXFXKXXPXPPP-XAPKXLKXP 703 P + PPPP P P + + P PPP PPP AP+ P Sbjct: 108 PYRPPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPVLVPPPAPAPRPAPAP 161 >12_01_0838 - 7830944-7831444 Length = 166 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = -2 Query: 702 GXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPXXGGGGXFXGXXGXFG 535 G + G+ GGG G GG G G G GGGG G G G Sbjct: 103 GGAQGQGSGGGGGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGGDGGGGGGGG 158 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 PPPP P P PPP P PPP P + P Sbjct: 136 PPPPPPSHPALLPPDATAP---PPPPTSVAALPPPPPAQPDKRRREP 179 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 PPPP P P PPP P PPP P + P Sbjct: 135 PPPPPPSHPALLPPDATAP---PPPPTSVAALPPPPPPQPDKRRREP 178 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPPXFXKKXXLXPPXXPP 686 PP PP PPP P P + PPP PP PP Sbjct: 26 PPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPP-------PPPVGPP 66 >09_04_0506 - 18188785-18190599 Length = 604 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/51 (31%), Positives = 20/51 (39%) Frame = +2 Query: 554 PXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXPP 706 P + PPPP P + PL+ PPP + AP L PP Sbjct: 51 PPQPPPPPQQQQQPPPISQQPPPLQAPPPPP-QQQQQQQQLQAPPSLPPPP 100 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 527 GXXPKXPXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXA 682 G PK P PPPP P P P PPP PPP A Sbjct: 208 GIKPKLKG-PKGAPPPPPPPPPSPHRH----PAAHPPPPPHHPAPRPPPPMA 254 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 537 QXPPXPPKKXPPPXXXGPPXP 599 + PP PP PPP PP P Sbjct: 423 ELPPPPPLPPPPPPPPPPPPP 443 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 546 PXPPKKXPPPXXXGPPXPXXKKXFXX*XXPPP 641 P PP PPP PP P PPP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 >07_03_1432 - 26508135-26508881,26509301-26509708 Length = 384 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/53 (26%), Positives = 16/53 (30%) Frame = +2 Query: 545 PXXPXKXPPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAPKXLKXP 703 P P P P P P+ PP + P PP AP P Sbjct: 35 PSPPSLSPSTPPTYPPPSSTPPSLAPVSPSPPTTYLPPSPTPPSPAPASPSPP 87 >06_02_0122 - 12095385-12095713,12096018-12096120 Length = 143 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -2 Query: 705 GGXFKXLGAXGGGXGXFFXKXGGGXXFXGKXXFXXXGXGXPX-XGGGGXFXGXXGXFG 535 GG + G GG G + GGG G G G GGGG + G G G Sbjct: 84 GGGYGHPGYGGGYGGGYGRGYGGGYGGSGGGYGGGYGGGYGGGYGGGGGYGGGYGGGG 141 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 PPPP P P L P P P P P AP Sbjct: 174 PPPPPPRPPAPEYKPPTPTLTPIPTPEPSYGPPAPKPPAP 213 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +3 Query: 546 PXPPKKXPPPXXXGPPXPXXKKXFXX*XXP--PPXFXKKXXLXPPXXPPXF*XPP 704 P PP + PPP P P PP F + L P PP PP Sbjct: 44 PGPPSQPPPPQAMYQAHPQYPMPGSLPPPPPRPPSFAPENALPPSSPPPPSPPPP 98 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 543 PPXPPKKXPPPXXXGPPXP 599 PP PP PPP PP P Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +2 Query: 566 PPPPXXGXPXPXXXKXFXPLKXXPPPXFXKXXPXPPPXAP 685 PP P P + P + PPP + P PPP P Sbjct: 3 PPAGLLPWPAPSAARLAAPTRTRPPPR-TRVRPPPPPAPP 41 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,848,728 Number of Sequences: 37544 Number of extensions: 384992 Number of successful extensions: 5376 Number of sequences better than 10.0: 95 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3151 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2588957540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -