BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O20 (911 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0005 + 11568545-11569119,11569179-11569191 34 0.14 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 33 0.24 09_06_0172 + 21329904-21331512,21331595-21331740,21332333-213325... 32 0.55 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.3 01_07_0082 - 40965947-40967023 31 1.3 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 31 1.7 05_01_0142 - 940421-940701,941262-941574 30 2.2 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 30 2.9 06_03_1037 - 27058002-27058082,27058856-27059041,27060033-270601... 29 3.9 02_04_0382 - 22501041-22501279,22501717-22501810 29 5.1 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 29 6.8 07_03_1160 - 24430240-24431268 29 6.8 03_06_0187 + 32209924-32210634 29 6.8 03_02_0457 + 8638318-8638336,8640394-8640497,8640613-8640778,864... 24 7.0 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = -2 Query: 577 PVSPXGXAXKPXXPPXP--PXGGXYGGGXG--XXPQXPXPFXRGXGGXLXXGG--XSPPX 416 P P P PP P P GG GGG G P P+ G GG GG PP Sbjct: 57 PPPPPVVTPTPQCPPPPSYPSGGGGGGGGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPPP 116 Query: 415 PG 410 G Sbjct: 117 TG 118 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 33.5 bits (73), Expect = 0.24 Identities = 24/67 (35%), Positives = 25/67 (37%) Frame = +3 Query: 414 GXGGXXPPXXXKPPXPRXKGXGFWGXXPXPPP*XPPXGGXGGXXGFXAXPXGETGXPKXX 593 G G PP P PR G G P PPP PP G G G P G P+ Sbjct: 346 GSGPPPPPPPAAPAAPRPPGPG-----PGPPP--PP--GAAGRGGGGPPPPALPGGPRAR 396 Query: 594 GXHQXKK 614 G KK Sbjct: 397 GPPPFKK 403 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = -2 Query: 583 GXPVSPXGXAXKPXXPPXPPXGGXYGGGXGXXPQXPXPFXRGXGGXLXXGGXSPPXPG 410 G P P P PP P G G G P P P G PP PG Sbjct: 319 GAPPPPPAHPAAPAPPPPAPSPSAAGAGSGP-PPPPPPAAPAAPRPPGPGPGPPPPPG 375 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 432 PPXXXKPPXPRXKGXGFWGXXPXPPP*XPPXGGXGGXXGFXAXPXGETGXP 584 PP PP P G P PP PP G G G P P Sbjct: 282 PPPPAPPPLP-PSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAP 331 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = -2 Query: 577 PVSPXGXAXKPXXPPXPPXGGXYGGGXGXXPQXPXPFXRGXGGXLXXGGXSPP 419 P +P A P P PP + G P P P G G G PP Sbjct: 273 PAAPPPPAGPPPPAP-PPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPP 324 >09_06_0172 + 21329904-21331512,21331595-21331740,21332333-21332556, 21333689-21334448 Length = 912 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -2 Query: 538 PPXPPXGGXYGGGXGXXPQXPXPFXR-GXGGXLXXGGXSPPXP 413 P PP G YGGG G PQ + + GG GG SPP P Sbjct: 294 PQAPPLG--YGGGYGYPPQGSSSYNQYAYGG--YYGGASPPPP 332 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 432 PPXXXKPPXPRXKGXGFWGXXPXPPP*XPPXGGXGG-----XXGFXAXPXGETGXPKXXG 596 PP PP P KG P PPP PP G GG G + P G P Sbjct: 348 PPAKGPPPPPPPKG-------PSPPPPPPPGGKKGGPPPPPPKGGASRPPAAPGVPTGSA 400 Query: 597 XHQXK 611 Q K Sbjct: 401 DQQAK 405 >01_07_0082 - 40965947-40967023 Length = 358 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 583 GXPVSPXGXAXKPXXPPXPPXGGXYGGGXGXXPQ 482 G P P PP PP G YGGG G PQ Sbjct: 263 GYPAQPPPPQAGYGYPPPPPQAG-YGGGYGYPPQ 295 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 538 PPXPPXGGXYGGGXGXXPQXPXPFXRGXGGXLXXGGXSPPXP 413 PP PP G GG G P + G GG GG P P Sbjct: 358 PPNPPYSGGAPGGQG---SLPPSYDGGYGGRPMPGGGGPGAP 396 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = +2 Query: 425 GXXPXXXXTPXPPGKGXXXLGXXPXPPPVXPXXXGXXGXXGFXGXXXGGNRXPQGXGXPP 604 G P P PPG G P PP P G G+ GG PQ G PP Sbjct: 39 GYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGGY--PPPGG--YPQHGGYPP 94 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 3/62 (4%) Frame = +3 Query: 420 GGXXPPXXX---KPPXPRXKGXGFWGXXPXPPP*XPPXGGXGGXXGFXAXPXGETGXPKX 590 GG PP PP P +G G G P PP P G G P G G P Sbjct: 1171 GGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPG-APAPPMPPGVPGGPPPPPGGRGLPAP 1229 Query: 591 XG 596 G Sbjct: 1230 PG 1231 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 538 PPXPPXGGXYGGGXGXXPQXPXPFXRGXGGXLXXGGXSPPXP 413 PP PP GG G P P F G GG +PP P Sbjct: 1149 PPPPPVGGL---GGPPAPPPPAGFRGGTPPPNAHGGVAPPPP 1187 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 408 IPGX-GGXXPPXXXKPPXPRXKGXGFWGXXPXPPP*XPPXGGXGG 539 +PG GG P PP G G P PP PP G G Sbjct: 1052 LPGEVGGAPSPPSPPPPQRENTSVGIQGGIPPLPPPLPPTLGDYG 1096 >06_03_1037 - 27058002-27058082,27058856-27059041,27060033-27060176, 27060284-27061183 Length = 436 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = -2 Query: 547 PXXPPXPPXGGXYGGGXGXXPQXPXPFXRGXGGXLXXGGXSPPXPGILKTKXXP 386 P P P GG P P RG G + SPP PG + + P Sbjct: 49 PPRAPGSPVPDDDDGGGADPFSSPAPIGRGRGEAVIPSVSSPPLPGAGRGRGSP 102 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 432 PPXXXKPPXPRXKGXGFWGXXPXPPP*XPPXG 527 P PP P G G +G P PPP P G Sbjct: 78 PDYYDPPPSPYYGGGGGYGKPPPPPPCCPCKG 109 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 420 GGXXPPXXXKPPXPRXKGXGFWGXXPXPPP*XPPXGGXGG 539 G PP PP R G G P PPP PP G Sbjct: 688 GPPPPPPPPLPPANRTNGPGVPSAPPPPPP-PPPANRSNG 726 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 432 PPXXXKPPXPRXKGXGFWGXXPXPPP*XPP 521 PP PP P F P PPP PP Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 >07_03_1160 - 24430240-24431268 Length = 342 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/58 (27%), Positives = 20/58 (34%) Frame = +3 Query: 348 PXKPGKXXRXXXXGXXXVLRIPGXGGXXPPXXXKPPXPRXKGXGFWGXXPXPPP*XPP 521 P KP + + G + P PP +PP P G P P P PP Sbjct: 251 PPKPDQPPQPCPDGPPKPDQPPQPNPNGPPKPDQPPQPNPNGPSKPDQPPRPNPDMPP 308 >03_06_0187 + 32209924-32210634 Length = 236 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/58 (29%), Positives = 20/58 (34%) Frame = -2 Query: 577 PVSPXGXAXKPXXPPXPPXGGXYGGGXGXXPQXPXPFXRGXGGXLXXGGXSPPXPGIL 404 PV+P P PP G GG P P P G G PP P ++ Sbjct: 175 PVNPGAVVPAVPALPVPPIPGAAGGVVPTLPVPPLPAVPGVPLPEVPGVPLPPVPSVV 232 >03_02_0457 + 8638318-8638336,8640394-8640497,8640613-8640778, 8641403-8641467 Length = 117 Score = 24.2 bits (50), Expect(2) = 7.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 688 GGPXGKXPXXGPXGG 644 GGP G P GP GG Sbjct: 60 GGPGGGGPGGGPYGG 74 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 526 PXGGXYGGGXG 494 P GG YGGG G Sbjct: 67 PGGGPYGGGRG 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,463,406 Number of Sequences: 37544 Number of extensions: 286313 Number of successful extensions: 1164 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2588957540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -