BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O17 (893 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 31 0.016 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 7.5 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 9.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 30.7 bits (66), Expect = 0.016 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 706 PKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQPI 822 P+ T D + APS+ P +P KP+T+T S+PI Sbjct: 2279 PENTECHPDASSTMAPSTTPMVP----DKPVTTTTSRPI 2313 Score = 25.0 bits (52), Expect = 0.80 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +1 Query: 685 KKTRSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQPIQYVQNKP 843 ++T + +P T+ T + P+ IP P+ P SQP + Q P Sbjct: 1058 RRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMPEVDKPSQPCEPGQYVP 1110 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TSTASQ Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQ 164 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TSTASQ Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQ 164 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TSTASQ Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQ 164 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TSTASQ Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQ 164 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TSTASQ Sbjct: 80 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQ 120 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TSTASQ Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQ 164 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TSTASQ Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQ 164 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 7.5 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 Query: 694 RSRKPKFTAVETDIKYSKAPSSEPAIPGPSQSKPITSTASQ 816 RS P T ++ S +S ++ KP TST SQ Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQ 164 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 9.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +1 Query: 460 KLTQTDNSKAEVPKTEAPKTEALKPEAPIPEACKSEAPKSEESK 591 ++T N + PKT P+ ++ + KSE K ES+ Sbjct: 143 RITDPINIRKCKPKTVVPEVGGVEEAKGPVDLSKSEPEKKTESQ 186 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,121 Number of Sequences: 336 Number of extensions: 2944 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24823920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -