BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O16 (892 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 25 0.60 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 3.2 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 23 4.3 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 7.4 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 9.8 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 25.4 bits (53), Expect = 0.60 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 585 NTTRKMIQTSFPHAVCKKPWHWYH 514 N+T K + T PH P+ +YH Sbjct: 5 NSTEKFLPTVLPHQEVPPPFGYYH 28 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 211 VARECAQVGKKPLIIKADISNDEE 282 VA Q GKKP +K + +DEE Sbjct: 66 VAGGVQQAGKKPENVKKEDESDEE 89 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 22.6 bits (46), Expect = 4.3 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 451 AAPHLIETKGNIINVSSIGGTMVPMPGFLA-YC 546 +AP + G+ +N+ +G PGF YC Sbjct: 33 SAPSICGEHGHCVNLPGVGHRCQCQPGFTGKYC 65 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 439 ITSLAAPHLIETKGNIINVSSIGGTMVPMPG 531 + S PH + G + V GG + P PG Sbjct: 18 VVSAEHPHQHQHYGAAVQVPQGGGAVQPDPG 48 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -3 Query: 134 APIPELPPVTRTTLFVKLITSTPFKVPA*TQILRNSL 24 +P+ LPP T ++ T + Q+LRN + Sbjct: 480 SPMSSLPPYPNRTQITEVTQQTEPSIYQHDQLLRNKV 516 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,568 Number of Sequences: 336 Number of extensions: 4088 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24720487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -