BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O15 (906 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 161 9e-40 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 143 2e-34 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 143 2e-34 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 129 3e-30 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 5e-28 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 120 2e-27 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 117 2e-26 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 117 2e-26 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 116 2e-26 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 116 3e-26 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 113 2e-25 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 106 3e-23 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 105 4e-23 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 6e-19 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 79 4e-15 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 47 2e-05 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 44 2e-04 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 43 3e-04 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) 38 0.008 SB_606| Best HMM Match : HMG_box (HMM E-Value=0.19) 38 0.008 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 38 0.011 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 38 0.011 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 37 0.019 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 37 0.019 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 35 0.079 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.079 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 34 0.18 SB_47133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) 29 3.9 SB_162| Best HMM Match : Extensin_2 (HMM E-Value=0.79) 29 5.2 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 5.2 SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) 29 5.2 SB_1173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 161 bits (390), Expect = 9e-40 Identities = 73/93 (78%), Positives = 84/93 (90%) Frame = +1 Query: 439 SKNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFID 618 +K ++A+RVKRPMNAFMVWSR +RRKMA DNPKMHNSEISKRLG++WK LSE EKRP+ID Sbjct: 781 TKANSADRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQEKRPYID 840 Query: 619 EAKRLRAVHMKEHPDYKYRPRRKTKTPGLKNKK 717 EA+RLRAVHMKEHPDYKYRPRRK+KT K+ K Sbjct: 841 EARRLRAVHMKEHPDYKYRPRRKSKTLLKKDNK 873 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 143 bits (347), Expect = 2e-34 Identities = 60/80 (75%), Positives = 73/80 (91%) Frame = +1 Query: 457 ERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLR 636 E VKRPMNAFMVWSR +RRK+A +NPKMHNSEISKRLG++WK L++ +K+PF++EAK+LR Sbjct: 325 EHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLR 384 Query: 637 AVHMKEHPDYKYRPRRKTKT 696 A HMKEHPDYKYRPRRK K+ Sbjct: 385 AQHMKEHPDYKYRPRRKPKS 404 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 143 bits (347), Expect = 2e-34 Identities = 60/80 (75%), Positives = 73/80 (91%) Frame = +1 Query: 457 ERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLR 636 E VKRPMNAFMVWSR +RRK+A +NPKMHNSEISKRLG++WK L++ +K+PF++EAK+LR Sbjct: 8 EHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLR 67 Query: 637 AVHMKEHPDYKYRPRRKTKT 696 A HMKEHPDYKYRPRRK K+ Sbjct: 68 AQHMKEHPDYKYRPRRKPKS 87 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 129 bits (312), Expect = 3e-30 Identities = 56/82 (68%), Positives = 71/82 (86%) Frame = +1 Query: 442 KNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDE 621 K S+ + VKRPMNAFMVWS+ +RRKMA ++P MHN+EISKRLG +WK LSESEKRPF++E Sbjct: 38 KKSDMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEE 97 Query: 622 AKRLRAVHMKEHPDYKYRPRRK 687 ++RLR HM+ +PDYKYRPR+K Sbjct: 98 SERLRIRHMQAYPDYKYRPRKK 119 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 122 bits (293), Expect = 5e-28 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 1/85 (1%) Frame = +1 Query: 457 ERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLR 636 + +KRPMNA+MVWSR +RR++A + P+M NSEISKRLG +W L+ EK+P+++EAKRLR Sbjct: 6 DHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSLTLDEKQPYVEEAKRLR 65 Query: 637 AVHMKEHPDYKYRPRRKTKT-PGLK 708 +H K+HPDYKY+P+RK KT P LK Sbjct: 66 ELHKKDHPDYKYQPKRKPKTSPKLK 90 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 120 bits (289), Expect = 2e-27 Identities = 47/82 (57%), Positives = 69/82 (84%) Frame = +1 Query: 442 KNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDE 621 K+ ER+KRPMNAFMVW++ +RR++A NP++HN+E+SK LG W+ L+ ++KRPF+DE Sbjct: 359 KDDETERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRALNSTQKRPFVDE 418 Query: 622 AKRLRAVHMKEHPDYKYRPRRK 687 A+RLR HM+++P+YKYRPRR+ Sbjct: 419 AERLRLQHMQDYPNYKYRPRRR 440 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 117 bits (281), Expect = 2e-26 Identities = 49/86 (56%), Positives = 65/86 (75%) Frame = +1 Query: 448 SNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAK 627 S+ +KRPMNAFM+WS +RR++A++NPK+HNS+ISK LG +W+ L+ EK+ F EAK Sbjct: 2 SSGSHIKRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAK 61 Query: 628 RLRAVHMKEHPDYKYRPRRKTKTPGL 705 L +HM EHPDYKYRPRR+ K L Sbjct: 62 LLNELHMIEHPDYKYRPRRRVKKRSL 87 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 117 bits (281), Expect = 2e-26 Identities = 49/86 (56%), Positives = 65/86 (75%) Frame = +1 Query: 448 SNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAK 627 S+ +KRPMNAFM+WS +RR++A++NPK+HNS+ISK LG +W+ L+ EK+ F EAK Sbjct: 2 SSGSHIKRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAK 61 Query: 628 RLRAVHMKEHPDYKYRPRRKTKTPGL 705 L +HM EHPDYKYRPRR+ K L Sbjct: 62 LLNELHMIEHPDYKYRPRRRVKKRSL 87 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 116 bits (280), Expect = 2e-26 Identities = 54/90 (60%), Positives = 68/90 (75%), Gaps = 1/90 (1%) Frame = +1 Query: 457 ERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLR 636 + +KRPMNAFMVWSR +RRK+A P M N EISK LGA+W LSE EKRPF+ EAKRLR Sbjct: 7 QHIKRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEKRPFVTEAKRLR 66 Query: 637 AVHMKEHPDYKYRP-RRKTKTPGLKNKKNT 723 +H +++PDY Y+P RRK+KT K+ +T Sbjct: 67 TIHNQKYPDYSYKPRRRKSKTVKSKDVYST 96 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 116 bits (279), Expect = 3e-26 Identities = 49/75 (65%), Positives = 62/75 (82%) Frame = +1 Query: 463 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAV 642 VKRPMNAFMVW++ RRK+A P +HN+E+SK LG WK L++SEK+PFI+EA+RLR Sbjct: 64 VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDSEKKPFIEEAERLRIK 123 Query: 643 HMKEHPDYKYRPRRK 687 H +EHPDYKY+PRRK Sbjct: 124 HKREHPDYKYQPRRK 138 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 113 bits (271), Expect = 2e-25 Identities = 44/75 (58%), Positives = 62/75 (82%) Frame = +1 Query: 463 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAV 642 VKRPMN+FM+W++ RRK A +NPK+HN+EISK LG W +L+ +KRPF+++A+RLR Sbjct: 94 VKRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAERLRIR 153 Query: 643 HMKEHPDYKYRPRRK 687 HMKEHP+Y+Y P+R+ Sbjct: 154 HMKEHPNYRYTPKRR 168 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 109 bits (263), Expect = 2e-24 Identities = 45/79 (56%), Positives = 62/79 (78%) Frame = +1 Query: 460 RVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRA 639 +VKRPMN+FMVW++ RRK+A P +HN+E+SK LG W+ LS +EK+P++DEA RL Sbjct: 110 KVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRMLSAAEKQPYVDEAARLDK 169 Query: 640 VHMKEHPDYKYRPRRKTKT 696 H ++HPDYKYRPRR+ K+ Sbjct: 170 RHKEDHPDYKYRPRRRQKS 188 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 106 bits (254), Expect = 3e-23 Identities = 44/82 (53%), Positives = 63/82 (76%) Frame = +1 Query: 448 SNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAK 627 ++ + VKRP+N+FMVW++ +RR M +NPKM N+EISK LG +W+ + ESEK P+ +EA Sbjct: 5 ASQDHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPESEKLPYTEEAL 64 Query: 628 RLRAVHMKEHPDYKYRPRRKTK 693 RLR H +HP+Y+Y+PRRK K Sbjct: 65 RLRRQHKVDHPNYRYKPRRKHK 86 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 106 bits (254), Expect = 3e-23 Identities = 52/132 (39%), Positives = 73/132 (55%) Frame = +1 Query: 451 NAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKR 630 +A VKRPMNAFMVWS+ +RR + + P+MHNSEISK LG +WK + + K+P+I++AK Sbjct: 5 DANHVKRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDELKQPYIEKAKE 64 Query: 631 LRAVHMKEHPDYKYRPRRKTKTPGLKNKKNTHSXXXXXXXXXXXXXVSRANGTTTPRRLS 810 L+A H +E+P YKY+PRR+ L K + A G TP + Sbjct: 65 LQAQHSRENPGYKYKPRRRKPKQTLLKKAAYPFPYTSTEMAPHAMKMGYAGGMPTPESMY 124 Query: 811 NDTKRLHAQRIY 846 + Q Y Sbjct: 125 QQFYPMQGQPAY 136 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 105 bits (253), Expect = 4e-23 Identities = 40/83 (48%), Positives = 68/83 (81%) Frame = +1 Query: 448 SNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAK 627 S++E++KRP+NAF++WS+ +RR +A++NP+MHN +IS++LG +W+ L+E EK + +EAK Sbjct: 14 SSSEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAK 73 Query: 628 RLRAVHMKEHPDYKYRPRRKTKT 696 +L+ H + +P YKY+PR++ KT Sbjct: 74 KLKEEHKERYPHYKYQPRKRDKT 96 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 99 bits (238), Expect = 2e-21 Identities = 44/84 (52%), Positives = 61/84 (72%), Gaps = 1/84 (1%) Frame = +1 Query: 448 SNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAK 627 S VKRPMN FMVWSR +R ++ +NP ++N+ +SK LG WK LS EK P+I++AK Sbjct: 3 SKKTHVKRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAK 62 Query: 628 RLRAVHMKEHPDYKYRP-RRKTKT 696 L +H ++HPDYKY+P RRK+K+ Sbjct: 63 HLTEMHKEKHPDYKYQPKRRKSKS 86 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 91.9 bits (218), Expect = 6e-19 Identities = 39/80 (48%), Positives = 55/80 (68%) Frame = +1 Query: 442 KNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDE 621 + N +VKRPMNAFM+W+R R +A P+ +N+EIS RLG W DLS +++P+ DE Sbjct: 94 RQENNAKVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQKPYFDE 153 Query: 622 AKRLRAVHMKEHPDYKYRPR 681 A RL+ H EHP++ Y+PR Sbjct: 154 ATRLKDKHKAEHPNWVYQPR 173 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 79.4 bits (187), Expect = 4e-15 Identities = 38/58 (65%), Positives = 43/58 (74%) Frame = +1 Query: 463 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLR 636 VK PMNAFMV SRG+R+ AS NP MHNSE SK LG +WK L+ EK PFI E KRL+ Sbjct: 9 VKSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKMLTSEEKDPFIAEPKRLQ 66 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 65.7 bits (153), Expect = 5e-11 Identities = 28/85 (32%), Positives = 49/85 (57%) Frame = +1 Query: 445 NSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEA 624 + + + ++RPMNAFM++S+ R + +P N +SK LG W L EK+ + A Sbjct: 510 DDSKDHIRRPMNAFMIFSKRHRALVHQKHPHQDNRTVSKILGEWWYALGPEEKQSYNALA 569 Query: 625 KRLRAVHMKEHPDYKYRPRRKTKTP 699 +++ H K HPD+K+ + + K+P Sbjct: 570 AQVKEAHFKAHPDWKWCTKDRKKSP 594 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/68 (29%), Positives = 45/68 (66%) Frame = +1 Query: 466 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVH 645 K P+ ++ + QR K+ S++P++ E++K LGA+W +S+ +K+ ++D+A+R + + Sbjct: 145 KAPLTGYVQFLNEQREKVRSEHPELPFPEVTKILGAEWSKMSQDDKQRYLDDAERDKERY 204 Query: 646 MKEHPDYK 669 + E +Y+ Sbjct: 205 IIELENYQ 212 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/99 (29%), Positives = 52/99 (52%), Gaps = 7/99 (7%) Frame = +1 Query: 442 KNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSES---EKRPF 612 K + KR M+A+M+W R+++ NP + +E+SK G WK+L++ E++ Sbjct: 535 KKKDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAA 594 Query: 613 IDEAKRLRAVHMKEHPDYKYRPRR----KTKTPGLKNKK 717 I++ K ++ MKE+ + K + K K+P K K Sbjct: 595 IEKQKYVQ--RMKEYNENKKNDKEESSPKKKSPSKKASK 631 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/72 (25%), Positives = 38/72 (52%) Frame = +1 Query: 463 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAV 642 V+ P++AF +W+ R+ + NP + ++ K+L +WK++ E K+ +I + K Sbjct: 227 VEPPLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKKEKTEMRK 286 Query: 643 HMKEHPDYKYRP 678 + K+ + P Sbjct: 287 YQKKIKEISVTP 298 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 7/99 (7%) Frame = +1 Query: 442 KNSNAERVKRPMNAFMVWSRGQRRKMASDNPK----MHNSEISKRLGAQWKDLSESEKRP 609 K + K+P NAF ++ + QR M D+ M + E++K L +W +L EK+ Sbjct: 48 KEKDPNAPKKPANAFFMFCQQQRTVMQEDHKDATAVMGHHELTKSLAKEWNNLLPDEKKV 107 Query: 610 FIDEAKRLR---AVHMKEHPDYKYRPRRKTKTPGLKNKK 717 + + +R + + MK++ K P +K K P K +K Sbjct: 108 YYEMYERDKERYELEMKQYSSDK-PPSKKQKDPSSKKRK 145 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 3/79 (3%) Frame = +1 Query: 442 KNSNAERVKRPMNAFMVWSR---GQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPF 612 K + + K P+ ++ + R +R + +P + EI+K LG +W L EK+ F Sbjct: 187 KEYDLNKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQKF 246 Query: 613 IDEAKRLRAVHMKEHPDYK 669 +DEA+ + +++E Y+ Sbjct: 247 LDEAEEDKKRYVEELRAYQ 265 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +1 Query: 466 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVH 645 KRP AF + + K+ +NP + ++EI K L QW +L S K + E ++ Sbjct: 307 KRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANLEPSVKECYRKEYQQ----D 362 Query: 646 MKE-HPDYKYRPRRKTKTPGLKNKKN 720 M+E YK PR+ + L ++N Sbjct: 363 MEEFRAPYKKLPRKPPRHFSLFMREN 388 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 466 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEK 603 ++P F ++ R K+ ++N M N +I + LGA+W++L SE+ Sbjct: 375 RKPPRHFSLFMRENFAKIKAENQGMSNPDIMRELGAKWRNLPFSER 420 >SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) Length = 169 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/49 (34%), Positives = 29/49 (59%) Frame = +1 Query: 535 KMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPR 681 ++ + IS LG +WK + + E++ ++ EAK+L H K +PD R R Sbjct: 106 EIEHRAISVILGDKWKSMKQEERKQYVMEAKQLAEEHKKVNPDCWKRKR 154 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 466 KRPMNAFMVWSRGQRRKMASDNPKMHNSE 552 KRPMNAFM++++ R ++ +P NS+ Sbjct: 32 KRPMNAFMLFAKRYRLEITQAHPGKDNSQ 60 >SB_606| Best HMM Match : HMG_box (HMM E-Value=0.19) Length = 159 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +1 Query: 544 NSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKT 690 N +IS LG W +SE KRPF + A+ L +P++KY +T Sbjct: 4 NRKISIMLGDYWNCMSEGHKRPFQEMARELMRKTKATYPEFKYSALEQT 52 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/56 (30%), Positives = 33/56 (58%) Frame = +1 Query: 466 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRL 633 ++P+ +M +SR ++ + NP +I K +G W+DL ++EK+ +EA +L Sbjct: 29 EKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDDAEKQQEYNEAVKL 84 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 7/86 (8%) Frame = +1 Query: 463 VKRPMNAFMVWSRGQRRKMA-----SDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAK 627 VKR +A++ ++ R K+ S P +E++K G +WK L++ +K+P++ +A+ Sbjct: 496 VKRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPYVAKAE 555 Query: 628 RLRAVHMKE--HPDYKYRPRRKTKTP 699 + ++KE D K P + + P Sbjct: 556 ADKQRYLKESGKNDPKKDPDKPKRPP 581 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 457 ERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPF-IDEAK 627 ++ KRP A+ ++ R++MA + +I G +W+++S+ +K+P+ I EA+ Sbjct: 575 DKPKRPPTAYFLFLAAFRKEMAGKALE-DGKKIPSLAGERWREMSDEDKKPYTIQEAE 631 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/82 (21%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = +1 Query: 469 RPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHM 648 +P++A+ ++ + + + NP EI+K +G W++L E +K+ + + + +A + Sbjct: 927 KPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQKKVYHCKHETAKAEYQ 986 Query: 649 KEHPDYKYRPRR-KTKTPGLKN 711 K + + + K K P L++ Sbjct: 987 KAMDELISKQKEPKAKLPKLES 1008 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +1 Query: 445 NSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEA 624 + A+R + N F +W R ++ +NP + + ++ K WK L EK+ + ++A Sbjct: 323 DEKADRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVWNEKA 382 Query: 625 K 627 K Sbjct: 383 K 383 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 35.1 bits (77), Expect = 0.079 Identities = 15/63 (23%), Positives = 36/63 (57%) Frame = +1 Query: 439 SKNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFID 618 S +S + KR + ++++S R + ++P+ EIS+ +G +W++ S + K + + Sbjct: 27 STDSGKKTKKRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYEN 86 Query: 619 EAK 627 +A+ Sbjct: 87 KAQ 89 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 35.1 bits (77), Expect = 0.079 Identities = 15/63 (23%), Positives = 36/63 (57%) Frame = +1 Query: 439 SKNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFID 618 S +S + KR + ++++S R + ++P+ EIS+ +G +W++ S + K + + Sbjct: 1260 STDSGKKTKKRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYEN 1319 Query: 619 EAK 627 +A+ Sbjct: 1320 KAQ 1322 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = +1 Query: 445 NSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKR 606 + A+R + N F +W R ++ +NP + + ++ K WK L EK+ Sbjct: 30 DEKADRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKK 83 >SB_47133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = -1 Query: 315 WQSHHAAERTQRPIAVLECMVRRHRCVKAAAFEIRLHRQHVVFLRRVQLADS 160 W + HAA+ R L+ +R R V++ ++R R+ +++RR Q+A S Sbjct: 166 WNNCHAAQEALRLAWGLKVDRKRRRSVRSKGIDLRERRKQPLWMRRHQIARS 217 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 2/75 (2%) Frame = +1 Query: 484 FMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDL--SESEKRPFIDEAKRLRAVHMKEH 657 ++ +++ R +AS NP + ++ I+ LGA W+D ++ P + + + K+ Sbjct: 299 YVKFTKAMRPAVASANPGVAHTRINALLGAMWQDFKTAQGPSSPASRSSSKKSSAKKKKA 358 Query: 658 PDYKYRPRRKTKTPG 702 + K KT G Sbjct: 359 QSKNKKAETKVKTRG 373 >SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) Length = 1311 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 463 VKRPMNAFMVWSRGQR 510 VKRPMN+FM+W++ R Sbjct: 1295 VKRPMNSFMIWAKVMR 1310 >SB_162| Best HMM Match : Extensin_2 (HMM E-Value=0.79) Length = 820 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 511 RKMASDN--PKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEH 657 R+MA DN P + +S+++ A WK EKRP +++ A + H Sbjct: 608 REMAQDNSTPGVTEKSLSRKI-ADWKHRETKEKRPTASKSETKAATNGASH 657 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 520 ASDNPKMHNSEI-SKRLGAQWKDLSESEKRPFIDEAKRLR 636 A+DN ++ SK GA+ KDL +S K+P DE + L+ Sbjct: 1768 AADNDRLERELAKSKEDGAKLKDLEDSGKQPENDETRALQ 1807 >SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) Length = 711 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/74 (27%), Positives = 29/74 (39%) Frame = -3 Query: 289 HPATHSRAGVHGAAAPLREGCRL*DPSPSSACRLPAARTACRFLRSQCTTKNYRSVTWTR 110 HP SR G EG R D + + LP + C F + + +Y VT Sbjct: 426 HPTNMSRTLPEGQDQCYFEGRRAYDNYTNMSRTLPEGQGQCYFEGKEISRSSYEHVTNLA 485 Query: 109 GGARVIVTLHRTVE 68 GAR ++ R + Sbjct: 486 RGARPVLLRRRAYD 499 >SB_1173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 185 CGAYSLPIPSFT-VHNEKLSVGHM 117 CGAYSLPI S T ++++++ +G M Sbjct: 9 CGAYSLPIRSATLINDQQMKLGKM 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,737,127 Number of Sequences: 59808 Number of extensions: 482021 Number of successful extensions: 1459 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1452 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -