BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O10 (885 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 3.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 4.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.5 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.0 bits (47), Expect = 3.7 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -2 Query: 818 RLRGSVPXCWFATFRSAGGEPSSILLH 738 R +GS+ CW +A E S+ H Sbjct: 207 RRKGSIARCWSLDSTAASDEDISLTTH 233 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.7 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 612 SNWVW*TPELSGMAHP 565 ++W+W P +SG A P Sbjct: 385 ADWLWIVPPISGSATP 400 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 314 LINHCPSKILILQVFLSFSQNHFSVMMKLMRP 219 +++ CPS ++ LQV ++ SQ ++ K P Sbjct: 853 VLSGCPSNMMELQVDIADSQQPLNLSKKSPSP 884 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 6.5 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +2 Query: 485 RLRVCH--TRQLRVRHTRQLRGAPYPTTQGCAIPDNSGVYH 601 R R H TRQ+ V +R A + I +NSGV H Sbjct: 208 RCRTMHRLTRQVVVSSVANVRIADHRGVMPPVILENSGVVH 248 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 6.5 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +2 Query: 485 RLRVCH--TRQLRVRHTRQLRGAPYPTTQGCAIPDNSGVYH 601 R R H TRQ+ V +R A + I +NSGV H Sbjct: 208 RCRTMHRLTRQVVVSSVANVRIADHRGVMPPVILENSGVVH 248 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,102 Number of Sequences: 438 Number of extensions: 5431 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28766349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -