BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O08 (876 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00003BFB0D Cluster: PREDICTED: hypothetical protein;... 36 1.4 UniRef50_Q89UH4 Cluster: Blr1443 protein; n=3; Bradyrhizobium|Re... 36 1.8 >UniRef50_UPI00003BFB0D Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 133 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = +1 Query: 346 MAFMMPVVKNDWDIYNS 396 MAFMMPV+KN+WDIY + Sbjct: 1 MAFMMPVMKNEWDIYKT 17 >UniRef50_Q89UH4 Cluster: Blr1443 protein; n=3; Bradyrhizobium|Rep: Blr1443 protein - Bradyrhizobium japonicum Length = 275 Score = 35.5 bits (78), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -1 Query: 405 GPLRVVYVPIVLHYWHHERHLGEGGGDSFVGTF 307 GP + V V H WHH L EGG +F GTF Sbjct: 202 GPFKYVLATPVFHRWHH-TSLEEGGDTNFAGTF 233 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,882,169 Number of Sequences: 1657284 Number of extensions: 11821330 Number of successful extensions: 24787 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24775 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 78292544701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -