BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_O02 (816 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.9 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 5.1 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 489 PPXIFPXXPPLXXPP 533 PP +FP P+ PP Sbjct: 187 PPGVFPVDAPMHSPP 201 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +1 Query: 490 PXXFSPXNPXXXFPXGGXXPXF*KRKKNFXKGXPXXP 600 P + NP GG P KR K+ G P P Sbjct: 51 PYHANHVNPTANHVMGGAVPDVGKRDKDAIYGHPLFP 87 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,146 Number of Sequences: 336 Number of extensions: 1924 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -