BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N22 (904 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.4 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 26 1.8 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 7.3 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 26.2 bits (55), Expect = 1.4 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = -3 Query: 437 PPPXPEKKXKXKGGXKXXXPXXKGAQQXPXXPXFPXKXXFXPXXXXGGAPPPXGXFPXXG 258 PPP P P + P P P + F G P P Sbjct: 530 PPPPPPPGGAVLNIPPQFLPPPLNLLRAPFFPLNPAQLRFP-----AGFPNLPNAQPPPA 584 Query: 257 PXXPPPKGGXPXP 219 P PPP G P P Sbjct: 585 PPPPPPMGPPPSP 597 Score = 25.4 bits (53), Expect = 2.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -3 Query: 560 PPXPKPXAPGXXGGXXXXGPKXKXPXPXGGGVFLSGXXXPXPPP 429 P P G G GP P P GG L+ PPP Sbjct: 508 PNDGPPHGAGYDGRDLTGGPLGPPPPPPPGGAVLNIPPQFLPPP 551 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.8 bits (54), Expect = 1.8 Identities = 20/92 (21%), Positives = 24/92 (26%) Frame = -3 Query: 560 PPXPKPXAPGXXGGXXXXGPKXKXPXPXGGGVFLSGXXXPXPPPXPEKKXKXKGGXKXXX 381 PP P+ P G G + P GG++ P P G Sbjct: 186 PPGPQMMRPPGNVGPPRTGTPTQPQPPRPGGMYPQPPGVPMPMRPQMPPGAVPGMQPGMQ 245 Query: 380 PXXKGAQQXPXXPXFPXKXXFXPXXXXGGAPP 285 P AQ P P GG P Sbjct: 246 PRPPSAQGMQRPPMMGQPPPIRPPNPMGGPRP 277 Score = 25.4 bits (53), Expect = 2.4 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = -3 Query: 563 PPPXPKPXAPGXX-----GGXXXXGPKXKXPXPXGGG 468 PPP +P AP GG G K P GGG Sbjct: 495 PPPGGRPNAPNPSSAVTPGGGRAEGDKVTFQIPNGGG 531 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 7.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 535 GAXGFGXGGGXXPPPRGXFC 594 G+ G G GGG P G C Sbjct: 1035 GSVGGGGGGGGSDEPNGMLC 1054 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,005 Number of Sequences: 2352 Number of extensions: 6403 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -