BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N18 (897 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0572 - 4044610-4044658,4044754-4044857,4044942-4044944 95 9e-20 02_05_1078 + 33946902-33946904,33947006-33947109,33947206-33947254 95 9e-20 02_05_1076 + 33932543-33932545,33932643-33932746,33932859-33932907 95 9e-20 11_06_0478 + 24073295-24074172,24074790-24075090 29 6.6 09_02_0565 + 10710770-10711003,10711368-10711527,10712277-107124... 29 6.6 03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 29 6.6 >06_01_0572 - 4044610-4044658,4044754-4044857,4044942-4044944 Length = 51 Score = 94.7 bits (225), Expect = 9e-20 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +3 Query: 78 MSAHKTFIIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKL 224 M +HKTF IK+KLAKK++QNRPIP W+RMRT NTIRYNAKRRHWRRTKL Sbjct: 1 MPSHKTFQIKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKL 49 >02_05_1078 + 33946902-33946904,33947006-33947109,33947206-33947254 Length = 51 Score = 94.7 bits (225), Expect = 9e-20 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +3 Query: 78 MSAHKTFIIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKL 224 M +HKTF IK+KLAKK++QNRPIP W+RMRT NTIRYNAKRRHWRRTKL Sbjct: 1 MPSHKTFRIKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKL 49 >02_05_1076 + 33932543-33932545,33932643-33932746,33932859-33932907 Length = 51 Score = 94.7 bits (225), Expect = 9e-20 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +3 Query: 78 MSAHKTFIIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKL 224 M +HKTF IK+KLAKK++QNRPIP W+RMRT NTIRYNAKRRHWRRTKL Sbjct: 1 MPSHKTFRIKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKL 49 >11_06_0478 + 24073295-24074172,24074790-24075090 Length = 392 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +1 Query: 61 QLDCSKCRPIRRLLLSANWPKS*NKTDPFLSG*GCAQETLF 183 QL C C + LSA WP K D F S G +E +F Sbjct: 207 QLFCLMCWQVEYQYLSAEWPPPSYKIDAFSSRTGRWEERVF 247 >09_02_0565 + 10710770-10711003,10711368-10711527,10712277-10712477, 10712564-10712628,10712740-10712767,10712847-10712923, 10713023-10713109,10713572-10713622,10713857-10713937, 10714125-10714346,10714424-10714517,10714608-10714748, 10716383-10716444,10716519-10717106 Length = 696 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 90 KTFIIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKR 200 K IIKR+ AK+L+Q P++ + TG +AKR Sbjct: 214 KETIIKREAAKRLEQTSEEPEYAPLPTGPGAVADAKR 250 >03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 Length = 356 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/50 (44%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +1 Query: 640 PXPRSLTRCARSF--GCGXRYQLTQRR*YGYPQNQGITQ--EXTCXQKAT 777 P PRS RC GCG R Q TQR P N IT E TC +T Sbjct: 150 PYPRSYYRCTHKLDQGCGARRQ-TQRC-EADPSNYDITYYGEHTCRDPST 197 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,312,335 Number of Sequences: 37544 Number of extensions: 209312 Number of successful extensions: 436 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -