BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N12 (989 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0833 - 25196091-25196372,25196464-25196565,25196640-251968... 31 1.9 08_01_0156 - 1233431-1233925 29 7.6 >06_03_0833 - 25196091-25196372,25196464-25196565,25196640-25196838, 25196978-25197278,25197471-25197645,25197842-25198012, 25198207-25198239 Length = 420 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = +2 Query: 521 CWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 679 CWR + T D Q + +KD P + PSC L+F P P Sbjct: 283 CWRHFLNQDFAMFATAGDDQWNPEDHLPSFKDDSLIPYDVPSCHLIFIPLLQP 335 >08_01_0156 - 1233431-1233925 Length = 164 Score = 28.7 bits (61), Expect = 7.6 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = -3 Query: 774 LGANDLHRTEIPTA*AMRKRHASRREK--GGQVSGKRQGRNRRAHEGASRGKRLVSL*SC 601 LG D TE+ A A A+R E+ GG G R G RA + +G + Sbjct: 89 LGDADATATEVDAAAAAEAEAAARGERGDGGGDGGGRAGGRGRARDEREKGAAADRVLGV 148 Query: 600 RVSPPLT 580 R SP ++ Sbjct: 149 RASPTVS 155 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,126,662 Number of Sequences: 37544 Number of extensions: 509093 Number of successful extensions: 1579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1579 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2893540780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -