BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N07 (1045 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11310.1 68414.m01299 seven transmembrane MLO family protein ... 31 1.7 At1g18760.1 68414.m02339 zinc finger (C3HC4-type RING finger) fa... 30 2.2 At5g25050.1 68418.m02969 integral membrane transporter family pr... 29 3.8 At4g14970.1 68417.m02301 hypothetical protein 29 5.1 At3g22620.1 68416.m02856 protease inhibitor/seed storage/lipid t... 29 5.1 At4g19300.1 68417.m02844 hypothetical protein includes At2g10370... 29 6.7 At2g27980.1 68415.m03391 expressed protein 29 6.7 At2g02770.1 68415.m00220 COP1-interacting protein-related simila... 29 6.7 At1g35090.1 68414.m04349 hypothetical protein includes At2g10370... 29 6.7 At5g36050.1 68418.m04343 hypothetical protein includes At2g10370... 28 8.9 >At1g11310.1 68414.m01299 seven transmembrane MLO family protein / MLO-like protein 2 (MLO2) idenctical to membrane protein Mlo2 [Arabidopsis thaliana] gi|14091574|gb|AAK53795; similar to Mlo [Hordeum vulgare subsp. vulgare] gi|1877221|emb|CAB06083 SWISS-PROT:P93766 Length = 573 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 484 GSGPVHCSHNRTEGDSERGPSSRARR*NQSGKHRH 588 GS P+H HN E PSS + R + G H H Sbjct: 489 GSSPIHLLHNFNNRSVENYPSSPSPRYSGHGHHEH 523 >At1g18760.1 68414.m02339 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 224 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 113 VLVILFQFRNCQEIPEEVSSEDEKLSEGEKKLSHNILAILE 235 +LV L F N + I EE E+E LSE E ++ + A LE Sbjct: 102 LLVSLLIFPNDEPIEEEYEIEEEDLSEEEDQIEEAVRASLE 142 >At5g25050.1 68418.m02969 integral membrane transporter family protein similar to biopterin transporter (GI:3377706) [Leishmania mexicana]; contains 7 transmembrane domains; contains Pfam PF03092: BT1 family; contains TIGRFAMS TIGR00788: folate/biopterin transporter Length = 499 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 98 LPXCLVLVILFQFRNCQEIPEEVSSEDEKLSEGEKKLSHNI-LAILEH 238 LP C + ++ +N ++P+E+ ED + EK+ + N+ LA L H Sbjct: 447 LPLCFLFLVPKGDQNTFKLPDEIMGEDSDEEKDEKEGTRNLELASLVH 494 >At4g14970.1 68417.m02301 hypothetical protein Length = 1286 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +2 Query: 218 ILAILEHYKQPDPTGLPGAKLPD--PYPVPDVKQSLTLGTMNFKNIALYGTNEF 373 +L +LE ++ PT +P A PD P+P P K+ L +G F L N F Sbjct: 949 LLNLLEAFQ---PTEIPVANFPDFQPFPSPGTKEYLYIGVSYFFEDILNKGNYF 999 >At3g22620.1 68416.m02856 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 203 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 480 LNHVAKV*LPRACNFSRV-ITAWASIAPISA 391 +N V LPRACN RV + A+IAP +A Sbjct: 87 INRTTAVSLPRACNMPRVPLQCQANIAPAAA 117 >At4g19300.1 68417.m02844 hypothetical protein includes At2g10370, At5g36050, At1g35090, At1g44860, At4g19300, At1g42400, At3g43040, At3g42500 Length = 252 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 180 KNFRKAKKNSVIISWLFWSIINSRIPRGCRELNYQIHTQFRT 305 K FR +KN+V+I+ +W II R GC H T Sbjct: 195 KRFRAFRKNNVVIALAWWKII--RFYPGCNWFKIVSHAPIST 234 >At2g27980.1 68415.m03391 expressed protein Length = 1037 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 143 CQEIPEEVSSEDEKLSEGEKKLSHNILAILEHYKQPDPTGLPGAK-LPD 286 C+EI + + + GE+KLS+NIL L +QP+ P K PD Sbjct: 807 CEEINTTLGN---LIVRGEEKLSNNILNFLRKKEQPNEENCPDYKTTPD 852 >At2g02770.1 68415.m00220 COP1-interacting protein-related similar to COP1-interacting protein 4 (CIP4) [Arabidopsis thaliana] GI:13160646, COP1-interacting protein 4.1 (CIP4.1) [Arabidopsis thaliana] GI:13160650 Length = 548 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 185 LSEGEKKLSHNILAILEHYKQPDPTGLPGAKLPDP 289 L E E+K+ H++LA+ E + D A +PDP Sbjct: 454 LEEMERKIKHDVLALAERFYSADEVKFLSA-IPDP 487 >At1g35090.1 68414.m04349 hypothetical protein includes At2g10370, At5g36050, At1g35090, At1g44860, At4g19300, At1g42400, At3g43040, At3g42500 Length = 244 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 180 KNFRKAKKNSVIISWLFWSIINSRIPRGCRELNYQIHTQFRT 305 K FR +KN+V+I+ +W II R GC H T Sbjct: 187 KRFRAFRKNNVVIALAWWKII--RFYPGCNWFKIVSHAPIST 226 >At5g36050.1 68418.m04343 hypothetical protein includes At2g10370, At5g36050, At1g35090, At1g44860, At4g19300, At1g42400, At3g43040, At3g42500 Length = 252 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 180 KNFRKAKKNSVIISWLFWSIINSRIPRGCRELNYQIHTQFRT 305 K FR +KN+V+I+ +W II R GC H T Sbjct: 195 KRFRAFRKNNVVIALAWWKII--RFYPGCNWFKIVSHAPILT 234 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,791,613 Number of Sequences: 28952 Number of extensions: 260081 Number of successful extensions: 699 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2569571440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -