BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N01 (867 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces pombe... 30 0.37 SPBC119.02 |ubc4||ubiquitin conjugating enzyme Ubc4|Schizosaccha... 28 2.0 SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyce... 26 8.0 >SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces pombe|chr 2|||Manual Length = 523 Score = 30.3 bits (65), Expect = 0.37 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 292 SHDGSSVVAADDNLDINARVEEERRRMQPTKLESFFAITK 411 S +V A+ +D++A E+RRR + +KL SFFA K Sbjct: 368 SGSSPTVSRANSVIDVDAYPPEKRRRKEQSKLLSFFAKQK 407 >SPBC119.02 |ubc4||ubiquitin conjugating enzyme Ubc4|Schizosaccharomyces pombe|chr 2|||Manual Length = 147 Score = 27.9 bits (59), Expect = 2.0 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +1 Query: 712 VKNNGSIYLHVYIVPSGKSPDLTIDKTLLALTSLL 816 + +NGSI L I+ SP LTI K LL++ SLL Sbjct: 78 INSNGSICLD--ILRDQWSPALTISKVLLSICSLL 110 >SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 855 Score = 25.8 bits (54), Expect = 8.0 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 682 SLSKHNTIICVKNNGSIYLHVYIVPSGKSPDLTIDKTLLALTS 810 S S+H N S++LH P ++P + D +A+TS Sbjct: 188 SSSRHTADAQSITNASVHLHNSSSPLNRTPSVISDTLAVAITS 230 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,198,080 Number of Sequences: 5004 Number of extensions: 65318 Number of successful extensions: 153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 432473040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -