BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M24 (962 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 50 4e-06 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 42 6e-04 09_02_0495 + 9880714-9881196 33 0.001 01_03_0005 + 11568545-11569119,11569179-11569191 38 0.012 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 38 0.016 01_06_0565 + 30287253-30287502,30287522-30289010,30289133-302892... 36 0.048 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 36 0.064 02_05_0686 - 30900748-30902167,30903442-30904742 36 0.064 11_06_0610 - 25449085-25453284 35 0.11 07_03_1136 + 24218601-24218734,24218769-24219906 33 0.26 07_01_0080 + 587674-588510 31 1.0 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.0 03_01_0515 - 3864796-3865425 31 1.0 07_01_0479 + 3606663-3607448 26 1.1 06_03_1310 + 29238644-29240260 31 1.4 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 29 1.4 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 1.8 08_02_0758 + 20848078-20849579,20849660-20849850,20849944-208501... 31 1.8 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 31 1.8 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 31 1.8 01_01_0715 - 5542648-5543219,5543352-5543544 31 1.8 01_01_0083 + 631196-631675 31 1.8 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 26 2.2 02_01_0434 + 3158637-3159319,3159460-3159576,3160064-3160226,316... 26 2.3 12_02_1174 - 26696869-26698191 30 2.4 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 30 2.4 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 30 2.4 08_01_0059 - 394001-394708 30 2.4 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 30 2.4 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 30 2.4 06_01_0486 - 3455030-3455770 30 2.4 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 30 3.2 07_03_1382 - 26170563-26170631,26171151-26171843 30 3.2 05_01_0142 - 940421-940701,941262-941574 30 3.2 02_04_0382 - 22501041-22501279,22501717-22501810 30 3.2 02_01_0162 - 1126273-1126593,1126950-1127117,1127211-1127501,112... 30 3.2 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 26 3.8 12_01_0135 + 1042889-1044255,1045368-1045809 29 4.2 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 29 4.2 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 29 4.2 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 29 4.2 04_03_0799 - 19805190-19805749,19806316-19806403 29 4.2 02_04_0400 - 22608519-22608844,22609044-22609122 29 4.2 02_02_0522 - 11161385-11161537,11162513-11162668,11164176-111642... 29 4.2 01_01_0895 + 7052118-7053110,7053249-7053252,7054450-7055189 29 4.2 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 29 4.2 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 29 5.5 09_02_0603 - 11150739-11150746,11150791-11151340 29 5.5 04_04_1435 + 33585508-33586490,33586646-33586664 29 5.5 03_05_1163 - 30847591-30847663,30847909-30848042,30848443-308484... 29 5.5 09_03_0145 - 12749288-12751510 29 7.3 08_02_0186 + 13965960-13966424 29 7.3 07_03_1381 - 26166673-26166747,26166972-26167544 29 7.3 06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 29 7.3 06_03_0082 + 16363742-16364632 29 7.3 06_01_0561 - 3983308-3983564,3983652-3983775 29 7.3 05_02_0161 + 7199005-7199505,7200118-7200378,7201532-7201621 29 7.3 04_03_0960 - 21257219-21257953 29 7.3 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 7.3 01_01_0130 + 1182504-1182817,1183024-1183152,1183582-1183716,118... 29 7.3 05_04_0395 - 20921606-20921869,20921971-20922112,20922206-209223... 25 8.1 09_06_0125 - 21011757-21012428 28 9.6 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 28 9.6 05_04_0188 - 18883979-18884250,18885046-18885666,18885762-188858... 28 9.6 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 28 9.6 02_02_0029 + 6204557-6204734,6205105-6205207,6205970-6206108 28 9.6 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 28 9.6 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 49.6 bits (113), Expect = 4e-06 Identities = 39/125 (31%), Positives = 39/125 (31%), Gaps = 4/125 (3%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPP----XGGXXXFPPXXGGXXXKXX 760 PPP GG PPPPP GG PP GG PP G Sbjct: 1110 PPPPPPGGITGVPPPPP------IGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAP 1163 Query: 761 XXXXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPX 940 G G P GG P PPP PP G P P PPP Sbjct: 1164 PPPAGFRGGTPPPNAHGG---VAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPP- 1219 Query: 941 XPPXG 955 PP G Sbjct: 1220 -PPGG 1223 Score = 39.1 bits (87), Expect = 0.005 Identities = 34/124 (27%), Positives = 36/124 (29%), Gaps = 5/124 (4%) Frame = +2 Query: 599 PXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXXXGX 778 P GG P PPPP ++ G PPP PP G G Sbjct: 1053 PGEVGGAPSPPSPPPPQRENTSVGIQGGIPPLPPP------LPPTLGDYGVAPPPPSIG- 1105 Query: 779 XXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXG-----GGPPPXXXKXXXXXPPPXX 943 GA P G P PP PP GG PP PP Sbjct: 1106 -AGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPP 1164 Query: 944 PPXG 955 PP G Sbjct: 1165 PPAG 1168 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +3 Query: 594 PPPXGXGGVFXXPPPXPPXKKXXXXXXGGXGGVXPPXGGGKXXSPXXXGG 743 PPP G GGV PP PP G GG PP GG +P G Sbjct: 1187 PPPRGHGGV--GGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLPAPPGGRG 1234 Score = 35.9 bits (79), Expect = 0.048 Identities = 36/122 (29%), Positives = 37/122 (30%), Gaps = 5/122 (4%) Frame = -2 Query: 889 PPPXG--GXXFXXXFXGGGXXWXXXXXPPPPXXGXXPXXXXXXXXXXFXXXPPXXWGEXX 716 PPP G G G G P P G P PP Sbjct: 1113 PPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGG 1172 Query: 715 XPPPX--GGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGG-GXFFXXGKXXPXPPPGG 545 PPP GG PP PP GG GG PP P G G PPP G Sbjct: 1173 TPPPNAHGGVAPPPPPPRGH-----GGVGG-----PPTPPGAPAPPMPPGVPGGPPPPPG 1222 Query: 544 GK 539 G+ Sbjct: 1223 GR 1224 Score = 33.1 bits (72), Expect = 0.34 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 3/70 (4%) Frame = -2 Query: 742 PPXXWGEXXXPPPXGGXT--PPXPPXXXXXXFLXGGXGG-GXXKTPPXPXGGGXFFXXGK 572 P G PPP GG T PP PP GG GG PP P G G Sbjct: 1102 PSIGAGAPPPPPPPGGITGVPPPPP--------IGGLGGHQAPPAPPLPEGIG------- 1146 Query: 571 XXPXPPPGGG 542 P PPP GG Sbjct: 1147 GVPPPPPVGG 1156 Score = 31.1 bits (67), Expect = 1.4 Identities = 33/125 (26%), Positives = 35/125 (28%), Gaps = 3/125 (2%) Frame = +3 Query: 594 PPPXGXGGVFXXPPPXPPXKKXXXXXXGGXGGVXPPXGGGKXXSPXXXGGXXXKXNXXXX 773 PP G GV PP GG GV PP G GG Sbjct: 1089 PPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIG------GLGGHQAPPAPPLP 1142 Query: 774 XXXXGXXPXXGGGGXXXXXXXXPPPXKXXKKXXPP---XGGGXPPXXXIKXXRGXPPXKX 944 G P GG PPP + PP GG PP + G Sbjct: 1143 EGIGGVPPPPPVGG--LGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPT 1200 Query: 945 PPXGP 959 PP P Sbjct: 1201 PPGAP 1205 Score = 30.7 bits (66), Expect = 1.8 Identities = 36/130 (27%), Positives = 37/130 (28%) Frame = +1 Query: 544 PPXGGGXGXFFXXXXXXXXXGXXGXFFXPPPPXPXXKXXXXXXXGGXXXXPPPXGGXKXF 723 PP GG G G G PPP P GG PPP G Sbjct: 1124 PPPIGGLGGHQAPPAPPLPEGIGGV----PPPPPVG------GLGGPPAPPPPAG----- 1168 Query: 724 PPXXGGEXPXKXXFXXXXPXGGXTPXXGGGGXXXXXXXPPPPXXXXKXXPPXXGGGXPPX 903 GG P P P G GG P PP PP GG PP Sbjct: 1169 --FRGGTPPPNAHGGVAPPP---PPPRGHGGVGGP---PTPPGAPAPPMPPGVPGGPPPP 1220 Query: 904 GX*KXXXXPP 933 + PP Sbjct: 1221 PGGRGLPAPP 1230 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 8/60 (13%) Frame = -2 Query: 700 GGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXF--------FXXGKXXPXPPPGG 545 G +PP PP G GG PP P G + G P PPPGG Sbjct: 1058 GAPSPPSPPPPQRENTSVGIQGGIPPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGG 1117 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 42.3 bits (95), Expect = 6e-04 Identities = 33/124 (26%), Positives = 34/124 (27%), Gaps = 2/124 (1%) Frame = +2 Query: 593 PPPXGXGGXFXXP-PPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXX 769 PP G G F P PPPPP + G PP PP Sbjct: 653 PPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPP-ANRTNGPGVPSA 711 Query: 770 XGXXXGAXPXXXGGGXXXXXPXXPPP-XKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXP 946 P G P PPP K PP PPP PP P Sbjct: 712 PPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPP---APPPPPLMTGKKAPAPPPPP 768 Query: 947 PXGP 958 P P Sbjct: 769 PQAP 772 Score = 36.3 bits (80), Expect = 0.036 Identities = 30/125 (24%), Positives = 31/125 (24%), Gaps = 6/125 (4%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPP------XGGXXXFPPXXGGXXXK 754 PPP G F PPPPPP PPP PP Sbjct: 552 PPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPI 611 Query: 755 XXXXXXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPP 934 P P PPP + PP P P PP Sbjct: 612 LPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPP----PAPGIGNKFPAPPP 667 Query: 935 PXXPP 949 P PP Sbjct: 668 PPPPP 672 Score = 33.5 bits (73), Expect = 0.26 Identities = 29/122 (23%), Positives = 31/122 (25%) Frame = +2 Query: 584 KKXPPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXX 763 +K P P PPPPPP G PPP PP + Sbjct: 532 RKLPSPSPTAAAPPPPPPPPPPPS------GNKPAFSPPPPP-----PPPPPPPLPQSNY 580 Query: 764 XXXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXX 943 P P PPP P PPP PPP Sbjct: 581 ASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPP 640 Query: 944 PP 949 PP Sbjct: 641 PP 642 Score = 30.7 bits (66), Expect = 1.8 Identities = 33/143 (23%), Positives = 34/143 (23%), Gaps = 5/143 (3%) Frame = +2 Query: 545 PPXXXXXXXFSXXKKXPPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXF 724 PP S PPP PPPPPP PPP Sbjct: 591 PPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLV 650 Query: 725 PPXXG-GXXXK----XXXXXXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGG 889 PP G K P P PPP + P Sbjct: 651 PPPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGVPS 710 Query: 890 GPPPXXXKXXXXXPPPXXPPXGP 958 PPP PPP GP Sbjct: 711 APPP------PPPPPPANRSNGP 727 Score = 29.5 bits (63), Expect = 4.2 Identities = 33/140 (23%), Positives = 33/140 (23%), Gaps = 2/140 (1%) Frame = +2 Query: 545 PPXXXXXXXFSXXKKXPPPXGXGGXFXXP--PPPPPXQKXXXXXXGGXXXXXPPPXGGXX 718 PP S PPP P PPPPP PPP Sbjct: 572 PPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHS 631 Query: 719 XFPPXXGGXXXKXXXXXXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPP 898 PP P G G P PPP PP P Sbjct: 632 VLPP----PPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPP--------PPRSSSRTP 679 Query: 899 PXXXKXXXXXPPPXXPPXGP 958 PPP PP P Sbjct: 680 TGAATSSKGPPPPPPPPLPP 699 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 872 PPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 PP PPP K PPP PP P Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPPPP 573 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 483 PKXPXPPPPXQKXFFFXPFXXGXXPPPP 400 P P PPP K F P PPPP Sbjct: 547 PPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +2 Query: 830 PXXPPPX--KXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP K PP PPP PP PP P Sbjct: 549 PPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPP 593 Score = 28.3 bits (60), Expect = 9.6 Identities = 26/109 (23%), Positives = 29/109 (26%), Gaps = 2/109 (1%) Frame = -2 Query: 700 GGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXPXPP--PGGGKKXXX 527 G PP PP G PP P P PP P K Sbjct: 688 GPPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNP 747 Query: 526 XXXXXFFFXXLLXXPQXXXPPPXXPKXLFFXPXXXGXXPPPPXFFXXXG 380 L+ + PPP P+ P G PPPP G Sbjct: 748 PAPPP---PPLMTGKKAPAPPPPPPQ----APKPPGTVPPPPPLHGASG 789 >09_02_0495 + 9880714-9881196 Length = 160 Score = 32.7 bits (71), Expect(2) = 0.001 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 594 PPPXGXGGVFXXPPPXPPXKKXXXXXXGGXGGVXPPXGG 710 PPP G V PPP P GG GG GG Sbjct: 39 PPPIAGGAVNSYPPPPPAGSSSSSSSGGGDGGAGGLFGG 77 Score = 27.5 bits (58), Expect(2) = 0.001 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 804 GGGGXXXXXXXXPPPXKXXKKXXPPXGGGXP 896 G GG PPP PP GGG P Sbjct: 70 GAGGLFGGTYPPPPPGVMPGAFAPPFGGGFP 100 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/61 (39%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Frame = -2 Query: 712 PPPXGGXTPPXPPXXXXXXFLXGGXGGG--XXKTPPXP--XGGGXFFXXGKXXPXPPPGG 545 PPP TP PP GG GGG +PP P GGG G PPP G Sbjct: 59 PPPVVTPTPQCPPPPSYPSGGGGGGGGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPPPTG 118 Query: 544 G 542 G Sbjct: 119 G 119 Score = 35.1 bits (77), Expect = 0.084 Identities = 24/91 (26%), Positives = 27/91 (29%), Gaps = 3/91 (3%) Frame = -1 Query: 815 PPPPXXGVXPPXGXXXXXIXFXGXSPPXXGGXXFXPPXGGGXXXXPP---XXXXXXFFXX 645 PPPP G + + PP GG GGG PP + Sbjct: 70 PPPPSYPSGGGGGGGGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPPPTGGGGGGGGGWQQ 129 Query: 644 GXGGGGXKNXPXXPXXXXXXXXGKKXPXPPP 552 G GGGG P P PPP Sbjct: 130 GGGGGGAYPTPPPPNPFLPYFPFYYYSPPPP 160 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXXX 772 PPP PPP P G PPP GG Sbjct: 59 PPPVVTPTPQCPPPPSYPSGGGGGGGGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPPPTG 118 Query: 773 GXXXGAXPXXXGGGXXXXXPXXPPP 847 G G GGG P PPP Sbjct: 119 GGGGGGGGWQQGGGGGGAYPTPPPP 143 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 37.5 bits (83), Expect = 0.016 Identities = 31/123 (25%), Positives = 31/123 (25%), Gaps = 1/123 (0%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXXX 772 PPP G PPP PP G P P G Sbjct: 277 PPPAGP------PPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAA 330 Query: 773 GXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXP-PXXGGGPPPXXXKXXXXXPPPXXPP 949 P G P PPP P P G PPP PPP P Sbjct: 331 PAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALP 390 Query: 950 XGP 958 GP Sbjct: 391 GGP 393 Score = 33.5 bits (73), Expect = 0.26 Identities = 28/104 (26%), Positives = 28/104 (26%) Frame = -2 Query: 712 PPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXPXPPPGGGKKX 533 PPP G PP PP G PP P G G P PPP Sbjct: 276 PPPPAGPPPPAPPPLPPSHH----HHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAP 331 Query: 532 XXXXXXXFFFXXLLXXPQXXXPPPXXPKXLFFXPXXXGXXPPPP 401 PPP P P G PPPP Sbjct: 332 APPPPAPSPSAAGAGSGPPPPPPPAAPAAP--RPPGPGPGPPPP 373 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/63 (25%), Positives = 17/63 (26%) Frame = -2 Query: 727 GEXXXPPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXPXPPPG 548 G PPP P PP G G PP G P PP Sbjct: 317 GTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGA 376 Query: 547 GGK 539 G+ Sbjct: 377 AGR 379 >01_06_0565 + 30287253-30287502,30287522-30289010,30289133-30289277, 30289679-30289729 Length = 644 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = +1 Query: 694 PPPXGGXKXFPPXXGGEXPXKXXFXXXXPXGGXTPXXGGGGXXXXXXXPPPPXXXXKXXP 873 P P G P GG P P G +P GGG PP P Sbjct: 390 PSPASGTSPSTPGSGGYSPSTPCSAPPSPSSGTSPTTPGGGYSPSTPCNAPPSPSSDTSP 449 Query: 874 PXXGGGXPP 900 GGG P Sbjct: 450 TTPGGGNYP 458 Score = 30.3 bits (65), Expect = 2.4 Identities = 30/130 (23%), Positives = 32/130 (24%), Gaps = 10/130 (7%) Frame = +3 Query: 600 PXGXGGVFXXPPPXPPXKKXXXXXX--GGXGGVXP--------PXGGGKXXSPXXXGGXX 749 P G GG P PP GG GG P P G +P GG Sbjct: 221 PGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPSPSSGSSPTTPGGGGGYT 280 Query: 750 XKXNXXXXXXXXGXXPXXGGGGXXXXXXXXPPPXKXXKKXXPPXGGGXPPXXXIKXXRGX 929 + G GG PP P G PP I Sbjct: 281 PTPSDTPPSPSSGSSRTTPGGCSTPTPCGTPPAPSSGTSPTTPGGSYYPPTPSIGDVPPS 340 Query: 930 PPXKXPPXGP 959 P P P Sbjct: 341 PSSDTSPTTP 350 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = -2 Query: 742 PPXXWGEXXXPPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXP 563 P G P P G PP P GG TPP P G G Sbjct: 320 PTTPGGSYYPPTPSIGDVPPSPSSDTSPTTPGGGSPSTPCDTPPSPSSGTSPTTPGGGYY 379 Query: 562 XPPPGGG 542 P P G Sbjct: 380 PPTPSVG 386 Score = 28.7 bits (61), Expect = 7.3 Identities = 34/135 (25%), Positives = 35/135 (25%), Gaps = 16/135 (11%) Frame = +1 Query: 544 PPXGGGXGX---FFXXXXXXXXXGXXGXFFXPP---PPXPXXKXXXXXXXGGXXXXP--- 696 PP GGG G G G + P PP P GG P Sbjct: 95 PPQGGGGGYNPPSPSIGTSPTTPGGGGGYTPTPSDTPPSPSSDTSPSTPGGGCSSSPTPC 154 Query: 697 --PPXGGXKXFPPXXGG-----EXPXKXXFXXXXPXGGXTPXXGGGGXXXXXXXPPPPXX 855 PP P GG P TP GGG PP P Sbjct: 155 DAPPSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSS 214 Query: 856 XXKXXPPXXGGGXPP 900 P GGG P Sbjct: 215 DTSPTTPGGGGGYTP 229 Score = 28.3 bits (60), Expect = 9.6 Identities = 23/88 (26%), Positives = 23/88 (26%), Gaps = 2/88 (2%) Frame = -1 Query: 935 GGGXXXXFYXPXGGXPPPXXGGXFFXXFXGGGGXXXXXXXPPPPXXGVXP--PXGXXXXX 762 GGG Y P PP GG PP P G P P G Sbjct: 274 GGGGG---YTPTPSDTPPSPSSGSSRTTPGGCSTPTPCGTPPAPSSGTSPTTPGGSYYPP 330 Query: 761 IXFXGXSPPXXGGXXFXPPXGGGXXXXP 678 G PP GGG P Sbjct: 331 TPSIGDVPPSPSSDTSPTTPGGGSPSTP 358 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 35.5 bits (78), Expect = 0.064 Identities = 35/131 (26%), Positives = 36/131 (27%), Gaps = 10/131 (7%) Frame = +2 Query: 596 PPXGXGGXFXXPPP-----PPPXQKXXXXXXGGXXXXXPPPXGGXXXF-----PPXXGGX 745 PP GG PPP PPP Q+ PPP G F PP G Sbjct: 11 PPPPQGGFPPQPPPMNPYGPPPPQQPAYGHM-------PPPQGAPPPFLAPPPPPPPGPP 63 Query: 746 XXKXXXXXXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXX 925 G P PPP PP PPP Sbjct: 64 PPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPP---PPPPPSPPPSA 120 Query: 926 XPPPXXPPXGP 958 PPP PP P Sbjct: 121 PPPPPPPPTQP 131 Score = 33.5 bits (73), Expect = 0.26 Identities = 28/115 (24%), Positives = 29/115 (25%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXXX 772 PPP G F PPPPPP PPP F P Sbjct: 42 PPPQGAPPPFLAPPPPPP-------------PGPPPPHQPQFNFGPGPPQQQQPPPPPQM 88 Query: 773 GXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPP 937 P G P PPP PP P + PPP Sbjct: 89 YYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPP 949 P PPP PP GPPP PPP P Sbjct: 9 PHPPPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAP 48 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 483 PKXPXPPPPXQKXFFFXPFXXGXXPPPP 400 P P PPPP Q F F P PPP Sbjct: 57 PPPPGPPPPHQPQFNFGPGPPQQQQPPP 84 Score = 29.9 bits (64), Expect = 3.2 Identities = 36/147 (24%), Positives = 41/147 (27%), Gaps = 9/147 (6%) Frame = -2 Query: 814 PPPPXXGXXPXXXXXXXXXXFXXXPPXXWGEXXXPPPXGGXTP---------PXPPXXXX 662 PPPP G P + PP PPP G P P PP Sbjct: 11 PPPPQGGFPPQPPPMNP---YGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQ 67 Query: 661 XXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXPXPPPGGGKKXXXXXXXXFFFXXLLXXP 482 F G + PP P ++ + P PPP G P Sbjct: 68 PQFNFGPGPPQQQQPPPPPQ---MYY---QPPPPPPPYGVNSSQPPPPPP-----PPPSP 116 Query: 481 QXXXPPPXXPKXLFFXPXXXGXXPPPP 401 PPP P P PPPP Sbjct: 117 PPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 29.1 bits (62), Expect = 5.5 Identities = 31/106 (29%), Positives = 35/106 (33%) Frame = -2 Query: 712 PPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXPXPPPGGGKKX 533 PPP GG P PP G P P G F P PPPG Sbjct: 12 PPPQGGFPPQPPPMNPYGPPPPQQPAYGHM---PPPQGAPPPFL--APPPPPPPG----P 62 Query: 532 XXXXXXXFFFXXLLXXPQXXXPPPXXPKXLFFXPXXXGXXPPPPXF 395 F F PQ PPP P +++ P PPPP + Sbjct: 63 PPPHQPQFNFGP--GPPQQQQPPP--PPQMYYQP-----PPPPPPY 99 Score = 28.7 bits (61), Expect = 7.3 Identities = 27/113 (23%), Positives = 27/113 (23%), Gaps = 3/113 (2%) Frame = +2 Query: 629 PPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXXXGXXXGAXPXXX- 805 P PPPP PPP P G G P Sbjct: 9 PHPPPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQP 68 Query: 806 --GGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 G PPP PP PPP PPP PP P Sbjct: 69 QFNFGPGPPQQQQPPPPPQMYYQPPP-----PPPPYGVNSSQPPPPPPPPPSP 116 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 35.5 bits (78), Expect = 0.064 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP K PP G PPP K PPP PP GP Sbjct: 326 PPPPPPPKAAPPPPPPK--GPPPPPPAK----GPPPPPPPKGP 362 Score = 33.9 bits (74), Expect = 0.19 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = -2 Query: 814 PPPPXXGXXPXXXXXXXXXXFXXXPPXXWGEXXXPPPXGGXTPPXPPXXXXXXFLXGGXG 635 PPPP P PP G PPP G PP PP GG Sbjct: 328 PPPPPKAAPPPPPPKGPPP-----PPPAKGPPPPPPPKGPSPPPPPP--------PGGKK 374 Query: 634 GGXXKTPPXPXGG 596 GG PP P GG Sbjct: 375 GG--PPPPPPKGG 385 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXG 955 P PPP K PP PPP PPP P G Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGG 385 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 839 PPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXG 955 PPP PP G PPP K PPP PP G Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPK--GPSPPPPPPPGG 372 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXG---GGPPPXXXKXXXXXPP 934 P PPP K PP G GGPPP K PP Sbjct: 353 PPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPP 390 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXG--GGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP K PP PPP K PP PP P Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPP 357 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXXX 772 PPP PPPPP K PPP G PP G Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPP-PPPPKGPSPPPPPPPG 371 Query: 773 GXXXGAXPXXXGGG 814 G G P GG Sbjct: 372 GKKGGPPPPPPKGG 385 Score = 30.7 bits (66), Expect = 1.8 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = -2 Query: 742 PPXXWGEXXXPPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXP 563 PP PPP PP PP G K PP P G P Sbjct: 318 PPKPAAAAPPPPPPPKAAPPPPPPK-------GPPPPPPAKGPPPPPP-----PKGPSPP 365 Query: 562 XPPPGGGKK 536 PPP GGKK Sbjct: 366 PPPPPGGKK 374 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 584 KKXPPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGG 742 K PPP G PPP P G PPP G PP G Sbjct: 342 KGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAPG 394 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 840 PPPXKXXKKXXPPXGGGXPPXXXIKXXRGXPPXKXPPXGP 959 PPP PP G PP K PP K P P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPP 366 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 34.7 bits (76), Expect = 0.11 Identities = 28/120 (23%), Positives = 30/120 (25%), Gaps = 1/120 (0%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPP-PPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXX 769 PPP G PP PP +K PP G PP K Sbjct: 628 PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTP 687 Query: 770 XGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPP 949 P G PP K P PPP + PP PP Sbjct: 688 ESESSSPPPPAPEGHMPSPPKSTPPVEK--SPPTPESEASSPPPPAPEGHTPSPPKSSPP 745 Score = 29.1 bits (62), Expect = 5.5 Identities = 28/125 (22%), Positives = 30/125 (24%) Frame = +2 Query: 575 SXXKKXPPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXK 754 S PPP G P PP +K PP G PP K Sbjct: 656 SKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEK 715 Query: 755 XXXXXXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPP 934 P G PP K PP PP + PP Sbjct: 716 SPPTPESEASSPPPPAPEGHTPSPPKSSPPEEK--SPPIPPTSHTSPP--TPEEYTPSPP 771 Query: 935 PXXPP 949 PP Sbjct: 772 KSSPP 776 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 739 PXXWGEXXXPPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGG 593 P G P GG PP L G GGG PP P GGG Sbjct: 91 PPGGGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGG 139 Score = 31.5 bits (68), Expect = 1.0 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 5/76 (6%) Frame = +3 Query: 678 GXGGVXPP---XGGGKXXSPXXXGGXXXKXNXXXXXXXXGXXP--XXGGGGXXXXXXXXP 842 G GG PP GGG P GG G P GGGG P Sbjct: 102 GGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPP 161 Query: 843 PPXKXXKKXXPPXGGG 890 + PP GGG Sbjct: 162 GGGRGGALGRPPGGGG 177 Score = 29.1 bits (62), Expect = 5.5 Identities = 28/77 (36%), Positives = 29/77 (37%), Gaps = 10/77 (12%) Frame = -2 Query: 742 PPXXWGEXXXP--PPX----GGXTPPXPPXXXXXX----FLXGGXGGGXXKTPPXPXGGG 593 PP G P PP GG PP P L GG GGG PP GGG Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPP---GGG 164 Query: 592 XFFXXGKXXPXPPPGGG 542 G+ PPGGG Sbjct: 165 RGGALGR-----PPGGG 176 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 5/64 (7%) Frame = -3 Query: 948 GGFXGGGXXXXFLXSXGGG-----PPPXXGGXXFXXXXXGGGXXGXXXXXPPPXXXGXAP 784 GG GGG L GGG PP G GGG G P G P Sbjct: 136 GGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGP 195 Query: 783 XWXP 772 P Sbjct: 196 GRAP 199 >07_01_0080 + 587674-588510 Length = 278 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 773 GXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXP 946 G + P GG P PPP PP G PPP PPP P Sbjct: 72 GAASTSTPPRLGGDGMFRRPPPPPP--------PPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 542 SPPXXXXXXXFSXXKKXPPPXGXGGXFXXPPPPPP 646 +PP F PPP G PPPPPP Sbjct: 78 TPPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPP 112 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPP 646 PPP G PPPPPP Sbjct: 96 PPPPSSGSPPPPPPPPPP 113 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 785 GAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPP--XXXKXXXXXPPPXXPP 949 G P GG P PPP PP G PP PPP PP Sbjct: 255 GTLPNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPP 311 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 712 PPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXPXPPPGGG 542 PPP GG PP PP G PP P GG P PP G Sbjct: 297 PPPVGGTQPPPPPPPL--------ANGPPRSIPPPPMTGGAMANFTPGAPPRPPMQG 345 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 587 KXPPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPP 730 + PPP PPPPPP G PPP GG PP Sbjct: 266 RPPPPQVPPPPPQAPPPPPPNAPM-----GMPPRIPPPPVGGTQPPPP 308 >03_01_0515 - 3864796-3865425 Length = 209 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP PP PPP PPP PP P Sbjct: 71 PPPPPPPSVTSSPPPPPLP--PPPPPPAASPPPPPPSPPPPSP 111 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXP 946 P PPP PP PPP K PP P Sbjct: 86 PPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 >07_01_0479 + 3606663-3607448 Length = 261 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPP 937 P PPP PP G PPP PP Sbjct: 225 PGGPPPGMRPGMPPPPFRPGMPPPPPGPQQPGQNPP 260 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +2 Query: 620 FXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGG 742 F PP PP G PPP G P GG Sbjct: 187 FQRPPGVPPAFPGGPPPPPGPFMRGPPPMGPPQVRPGMPGG 227 >06_03_1310 + 29238644-29240260 Length = 538 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 542 SPPXXXXXXXFSXXKKXPPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPP 703 SPP K P P G + PPPPP K G PPP Sbjct: 479 SPPSSSWSPPQGGGGKLPFPPVHGVAYSSPPPPPSGDKLPFPPVYGVAYSSPPP 532 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 29.1 bits (62), Expect(2) = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = -2 Query: 688 PPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXG-------KXXPXPPP 551 PP P GG GGG K P GG G K P PPP Sbjct: 127 PPPPKPKPCECTYCGGHGGGCNKPAVPPCAGGCSISDGGACGASCKPPPPPPP 179 Score = 20.6 bits (41), Expect(2) = 1.4 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = -2 Query: 469 PPPXXPKXLFFXPXXXGXXPPPP 401 PPP P ++ PPPP Sbjct: 173 PPPPPPPAIWPPQPSFYYYPPPP 195 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 872 PPXXGGGPPPXXXKXXXXXPPPXXPPXG 955 PP G PPP PPP PP G Sbjct: 922 PPRPPGAPPPPPPPGKPGGPPPPPPPPG 949 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPP 700 PPP G PPPPPP GG P Sbjct: 930 PPPPPPGKPGGPPPPPPPPGSLPRNLAGGDKVHRAP 965 >08_02_0758 + 20848078-20849579,20849660-20849850,20849944-20850179, 20850254-20850973 Length = 882 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 584 KKXPPPXGXGGXFXXPPPPPP 646 +K PPP G + PPPPPP Sbjct: 435 QKNPPPNLKGQCYGQPPPPPP 455 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 839 PPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPP---XXPPXGP 958 PPP PP G PPP PP PP GP Sbjct: 648 PPPIAVAPPPAPPIAGAAPPPPMANGAAAAAPPGGNPAPPAGP 690 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = -3 Query: 492 WXXPKXPXPPPPXQKXFFFXPFXXGXXPPPPXFF 391 W P P PPPP + PPPP F Sbjct: 353 WVPPPPPPPPPPPPVYYSSYVMLDRPPPPPPQLF 386 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +2 Query: 542 SPPXXXXXXXFSXXKKXPPPXGXG--GXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGX 715 SPP + PPP G G P PP P G PPP GG Sbjct: 144 SPPPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAPA----GSPPPPPPPPAGGN 199 Query: 716 XXFPPXXGG 742 P GG Sbjct: 200 FTAPSPAGG 208 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = -2 Query: 709 PPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXGKXXPXPPPGGG 542 P G PP PP F GG T P P G + P GG Sbjct: 182 PAPAGSPPPPPPPPAGGNFTAPSPAGGMNFTAPAPGTNGTAAPPPRPSSAPSVRGG 237 >01_01_0083 + 631196-631675 Length = 159 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = +1 Query: 628 PPPPXPXXKXXXXXXXGGXXXXPPPXGGXKXFPPXXGGEXPXKXXFXXXXPXGGXTPXXG 807 PPP P PP +PP GG + P GG G Sbjct: 46 PPPSTPSSGYSYPPPSSSSSNTPPSSSSYWNYPPPQGGGGGYIPYYQP--PAGG-----G 98 Query: 808 GGGXXXXXXXPPPP 849 GGG PPPP Sbjct: 99 GGGGGFNYPAPPPP 112 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 26.2 bits (55), Expect(2) = 2.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 605 GXGGXFXXPPPPPP 646 G GG PPPPPP Sbjct: 93 GGGGWVQLPPPPPP 106 Score = 22.6 bits (46), Expect(2) = 2.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 629 PPPPPPXQ 652 PPPPPP Q Sbjct: 104 PPPPPPPQ 111 >02_01_0434 + 3158637-3159319,3159460-3159576,3160064-3160226, 3160394-3160600 Length = 389 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 629 PPPPPPXQKXXXXXXGGXXXXXPPP 703 PPPPPP G PPP Sbjct: 26 PPPPPPMPAYQYHATGACAAAAPPP 50 Score = 22.6 bits (46), Expect(2) = 2.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 620 FXXPPPPPP 646 F PPPPPP Sbjct: 21 FFAPPPPPP 29 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.3 bits (65), Expect = 2.4 Identities = 24/110 (21%), Positives = 25/110 (22%) Frame = +2 Query: 629 PPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXXXXGXXXGAXPXXXG 808 PPPPPP + P P PP P Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPP 183 Query: 809 GGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PP K PPP PPP PP P Sbjct: 184 SLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVPPRTP 233 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP + + PP P PPP PP P Sbjct: 123 PPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPP 165 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 839 PPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 PPP PP P + PPP PP GP Sbjct: 26 PPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGP 65 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/92 (23%), Positives = 24/92 (26%), Gaps = 1/92 (1%) Frame = +1 Query: 619 FFXPPPPXPXXKXXXXXXXGGXXXXPPPXGGXKXFPPXXGGEXPXKXXFXXXXPX-GGXT 795 F PPPP PP G + P + P G Sbjct: 241 FNSPPPPGQGPVLPRDAPPMPPPPSPPNPGAPPSYQPHAPNPQAGYTNYQGGVPGYQGRA 300 Query: 796 PXXGGGGXXXXXXXPPPPXXXXKXXPPXXGGG 891 P GG PPPP P GGG Sbjct: 301 PGYQGGNQEYRGPPPPPPSAYQGNNPGYQGGG 332 Score = 29.9 bits (64), Expect = 3.2 Identities = 28/103 (27%), Positives = 29/103 (28%), Gaps = 2/103 (1%) Frame = +2 Query: 593 PPPXGXGGXF--XXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXXXX 766 PPP G G PP PPP P P G + GG Sbjct: 244 PPPPGQGPVLPRDAPPMPPPPSPPNPGAPPSYQPHAPNPQAGYTNY---QGGVP------ 294 Query: 767 XXGXXXGAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGP 895 G P GG P PPP P GGGP Sbjct: 295 ---GYQGRAPGYQGGNQEYRGPPPPPPSAYQGN-NPGYQGGGP 333 >08_01_0059 - 394001-394708 Length = 235 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 839 PPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPP 949 PPP PP PPP PPP PP Sbjct: 36 PPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSPP 72 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PP + PP PPP PPP P GP Sbjct: 1150 PSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGP 1192 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 5/48 (10%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPP-----PXXXKXXXXXPPPXXPPXGP 958 P PPP PP G PP P PPP PP P Sbjct: 1126 PDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPP 1173 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP PP G PP PPP PP P Sbjct: 1177 PSLPPPPPP-----PPLPSGPPPQPAPPPLPIQPPPIPPPPVP 1214 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXG 955 P PPP K PP P + PPP PP G Sbjct: 55 PPPPPPPPQPAKEPPPPTKPKHPKPKQQQHPPPPPPQKPPQG 96 >06_01_0486 - 3455030-3455770 Length = 246 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP PP PPP PPP PP P Sbjct: 114 PYIPPPTPPYV---PPPTPPSPPPYVPPPTPPSPPPYVPPPSP 153 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 539 FSPPXXXXXXXFSXXKKXPPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXX 718 F+PP S PP G F PPPP PPP GG Sbjct: 43 FAPPGGNGPVPSSIRAPQAPPPG-ARPFPGSPPPPSQPPPPFARPAAPVQQQPPPFGGPP 101 Query: 719 XFPP 730 P Sbjct: 102 GVMP 105 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPP 703 PPP G PPPPPP + G PP Sbjct: 188 PPPQPSGDANENPPPPPPPLRTGVGNSDGRRARRDPP 224 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 785 GAXPXXXGGGXXXXXPXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXP 946 GA P G PPP + P GG PPP PP P Sbjct: 45 GAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGGYPPPGGYPQHGGYPPAGYP 98 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Frame = +2 Query: 593 PPPX---GXGGXFXXPPPPPP 646 PPP G GG + PPPPPP Sbjct: 83 PPPSPYYGGGGGYGKPPPPPP 103 >02_01_0162 - 1126273-1126593,1126950-1127117,1127211-1127501, 1127688-1127763,1127841-1127886,1128006-1128072, 1128162-1128234,1128321-1128561,1128669-1128822, 1128915-1129042,1129481-1129535,1129629-1129838 Length = 609 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 474 PXPPPPXQKXFFFXPFXXGXXPPP 403 P PPPP Q F P+ G PP Sbjct: 581 PPPPPPPQMELFCSPYHGGSRQPP 604 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 26.2 bits (55), Expect(2) = 3.8 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +2 Query: 629 PPPPPPXQKXXXXXXGGXXXXXPPP 703 PPPPPP + G PPP Sbjct: 231 PPPPPPPKPANIAGAPGLPLPPPPP 255 Score = 21.8 bits (44), Expect(2) = 3.8 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 596 PPXGXGGXFXXPPPPPP 646 P G PPPPPP Sbjct: 193 PGTEEAGPSTLPPPPPP 209 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXP 946 P PPP PP PPP PPP P Sbjct: 134 PAPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPAQP 172 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -2 Query: 808 PPXXGXXPXXXXXXXXXXFXXXPPXXWGEXXXPPP-XGGXTPPXP 677 PP G P + PP WG+ PPP G PP P Sbjct: 19 PPQWGAIPPPVPHQQQQ-YAPPPPQMWGQAPPPPPQMWGQAPPPP 62 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 838 PPPPXXXXKXXPPXXGGGXPPXGX*KXXXXPPPXKXP 948 PPPP + PP G PP G PPP P Sbjct: 95 PPPPLPQHRLEPPPPHYGFPPRGH-PDAYSPPPYHDP 130 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = -2 Query: 712 PPPXGGXTPPXPPXXXXXXFLXG----GXGGGXXKTPPXPXGGG 593 PPP PP PP F G G TPP P G G Sbjct: 53 PPPPMVAAPPPPPPQYAKHFAAGPPPAAAAGRRTPTPPAPAGSG 96 >04_03_0799 - 19805190-19805749,19806316-19806403 Length = 215 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = -2 Query: 688 PPXP-PXXXXXXFLXGGXGGGXXKTPPXPXGGGXFFXXG-----KXXPXPPP 551 PP P P GG GGG K P GGG G P PPP Sbjct: 129 PPKPKPKPCECTHHCGGHGGGCNKPAVSPCGGGCSISDGGACGASCKPPPPP 180 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -3 Query: 957 GPXGGFXGGGXXXXFLXSXGGGPPPXXGGXXFXXXXXGGGXXGXXXXXPPPXXXGXAP 784 G GG GGG GGG GG GGG G PP G P Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYP 103 >02_02_0522 - 11161385-11161537,11162513-11162668,11164176-11164298, 11164404-11164466,11164512-11164577,11165128-11165232, 11165336-11165435,11165520-11165590,11166037-11166093, 11167215-11167292,11167367-11167441,11168490-11168540, 11169015-11169094,11169560-11169660,11169749-11169810, 11170084-11170590 Length = 615 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = -2 Query: 742 PPXXWGEXXXPPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXPXGGG 593 PP W + PP GG GG GGG + GGG Sbjct: 85 PPEIWRQPGEAPPGGGARGAEVGRIDVVRVAAGGGGGGGDGSDGNEGGGG 134 >01_01_0895 + 7052118-7053110,7053249-7053252,7054450-7055189 Length = 578 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 575 SXXKKXPPPXGXGGXFXXPPPPPP 646 S K+ PPP G GG PP PP Sbjct: 30 STKKRPPPPCGDGGRRLPLPPSPP 53 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.5 bits (63), Expect = 4.2 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 4/78 (5%) Frame = +2 Query: 593 PPPXGXGGXFXXPPP----PPPXQKXXXXXXGGXXXXXPPPXGGXXXFPPXXGGXXXKXX 760 PPP GG PP PPP GG PP G P GG Sbjct: 338 PPPSSYGGGPGSYPPSYGAPPPNPPYSGGAPGGQGSL-PPSYDGGYGGRPMPGGGGPGAP 396 Query: 761 XXXXGXXXGAXPXXXGGG 814 G G GGG Sbjct: 397 PPYHGGGGGGGGGGGGGG 414 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/73 (30%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Frame = +1 Query: 676 GGXXXXPPPXGGXKXFPPXXGGEXPXKXXFXXXXPXG-GXTPXXGGGGXXXXXXXPPPPX 852 GG PP G PP GG + G G P GGGG PPP Sbjct: 345 GGPGSYPPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGG-----PGAPPPY 399 Query: 853 XXXKXXPPXXGGG 891 GGG Sbjct: 400 HGGGGGGGGGGGG 412 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = -1 Query: 809 PPXXGVXPPXGXXXXXIXFX-GXSPPXX-GGXXFXPPXGGGXXXXPPXXXXXXFFXXGXG 636 PP G PP G PP GG P GGG PP G G Sbjct: 351 PPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGGGGGGGGG 410 Query: 635 GGG 627 GGG Sbjct: 411 GGG 413 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 29.1 bits (62), Expect = 5.5 Identities = 24/97 (24%), Positives = 25/97 (25%), Gaps = 6/97 (6%) Frame = +1 Query: 619 FFXPPPPX-----PXXKXXXXXXXGGXXXXPPPXGGXKXFPPXXGGEXPXKXXFXXXXPX 783 F PPPP P G PPP G + P P Sbjct: 245 FNSPPPPGQGPVPPRDAPPMHHAQGNVPPPPPPNAGPPNYQPHAPNPQGYTNYQQGGAPG 304 Query: 784 -GGXTPXXGGGGXXXXXXXPPPPXXXXKXXPPXXGGG 891 G P G PPPP P GGG Sbjct: 305 YQGGPPGYQGSNQGYQGPPPPPPSAYQGNNPGYQGGG 341 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 495 FWXXPKXPXPPPPXQKXFFFXPFXXGXXPPPP 400 F P+ PPPP FF P PPPP Sbjct: 53 FVPLPQSGVPPPPPLGSFFVPPPQSRVPPPPP 84 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -1 Query: 815 PPPPXXGVXPPXGXXXXXIXFXGXSPPXXGGXXFXPPXGGGXXXXPP 675 PPP PP G + G PP G F PP PP Sbjct: 38 PPPFGFPPPPPPGSTFVPLPQSGVPPPPPLGSFFVPPPQSRVPPPPP 84 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 620 FXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPP 730 F PPPPPP G PPP G PP Sbjct: 41 FGFPPPPPPGSTFVPLPQSG--VPPPPPLGSFFVPPP 75 >04_04_1435 + 33585508-33586490,33586646-33586664 Length = 333 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQK 655 P P G G PPPPPP ++ Sbjct: 141 PAPAGRGNGTDEPPPPPPEEE 161 >03_05_1163 - 30847591-30847663,30847909-30848042,30848443-30848484, 30848613-30848654,30849362-30849461,30849605-30849666, 30851001-30851015,30851098-30851179,30853510-30853694 Length = 244 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 688 PPXPPXXXXXXFLXGGXGGGXXKTPPXP----XGGGXFFXXGKXXPXPPPGG 545 PP PP GG GG PP P G P PPPGG Sbjct: 186 PPQPPWNGNCSNGHGGGGGVFSSEPPQPEHFFQALGLHAVDVNQPPAPPPGG 237 >09_03_0145 - 12749288-12751510 Length = 740 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 629 PPPPPPXQKXXXXXXGGXXXXXPPP--XGGXXXFP 727 PPPPPP + G PPP GG FP Sbjct: 32 PPPPPPGIQPPPPALPGMPHGRPPPPFPGGRDAFP 66 >08_02_0186 + 13965960-13966424 Length = 154 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -2 Query: 742 PPXXWGEXXXPPPX--GGXTPPXPPXXXXXXFLXGGXGGGXXKTPPXP 605 P +G PPP G + PP GG GGG TP P Sbjct: 61 PLPIYGYPSPPPPSQPAGPSSHTPPCPPAAVVCCGGGGGGGQYTPQQP 108 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPP 646 PPP G PPPPPP Sbjct: 151 PPPCGDANENPPPPPPPP 168 >06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 Length = 627 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPP 949 P PPP P G PPP + PP PP Sbjct: 27 PHHPPPYAAPLPQYAPYARGMPPPQAQQLYSHLPPHQQPP 66 >06_03_0082 + 16363742-16364632 Length = 296 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = -2 Query: 655 FLXGGXGGGXXKTPPX-----PXGGGXFFXXGKXXPXPPP 551 +L G GGG PP GGG F G+ P PPP Sbjct: 134 WLEDGDGGGDGVEPPDWCCCCCCGGGDQFGGGEERPPPPP 173 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPP 700 PP GG PPPPP Q G PP Sbjct: 89 PPTSNDGGIESISPPPPPEQDGQFFSSTGYPTRPPP 124 >05_02_0161 + 7199005-7199505,7200118-7200378,7201532-7201621 Length = 283 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGG 712 PPP GG F PPPP GG PP G Sbjct: 51 PPPPDDGGEF----PPPPDDGGEGVSEGGAGVAGPPEADG 86 >04_03_0960 - 21257219-21257953 Length = 244 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 945 GFXGGGXXXXFLXSXGGGPPPXXGGXXFXXXXXGGGXXG 829 GF GGG FL S G P G GGG G Sbjct: 180 GFFGGGGNGRFLHSWSIGTSPSPSGSGSGGAGGGGGGGG 218 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 830 PXXPPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P PPP K PP PPP P P PP P Sbjct: 359 PPPPPPPKLNTAPKPPPPP--PPPPSVPSNNNLPKPAEPPAVP 399 >01_01_0130 + 1182504-1182817,1183024-1183152,1183582-1183716, 1184296-1184392,1184633-1184736,1184924-1184975, 1185261-1185458 Length = 342 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 Query: 688 PPXPPXXXXXXFLXGGXGGGXXKTPPXPXG 599 PP P + GG GGG PP P G Sbjct: 7 PPEDPEIFPSRMVTGGGGGGAGGGPPGPPG 36 >05_04_0395 - 20921606-20921869,20921971-20922112,20922206-20922330, 20922758-20923984 Length = 585 Score = 24.6 bits (51), Expect(2) = 8.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 614 GXFXXPPPPPP 646 G F PPPPPP Sbjct: 104 GEFDLPPPPPP 114 Score = 22.2 bits (45), Expect(2) = 8.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 629 PPPPPPXQK 655 PPPPPP K Sbjct: 110 PPPPPPPAK 118 >09_06_0125 - 21011757-21012428 Length = 223 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPP 646 PPP F PPPPPP Sbjct: 171 PPPPPPRAPFLAPPPPPP 188 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 712 PPPXGGXTPPXPPXXXXXXFLXGGXGGGXXKT 617 PPP G PP PP GG GGG T Sbjct: 5 PPPPGTGAPPPPPPAAVGP--PGGVGGGKPLT 34 >05_04_0188 - 18883979-18884250,18885046-18885666,18885762-18885887, 18886007-18886265 Length = 425 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 630 PPPXPPXKKXXXXXXGGXGG 689 PPP PP KK GG GG Sbjct: 30 PPPSPPHKKLWGGGGGGGGG 49 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +2 Query: 593 PPPXGXGGXFXXPPPPPPXQKXXXXXXGGXXXXXPPPXGGXXXFPP 730 P P G + PPPPP PPP G PP Sbjct: 433 PVPWGQPPPYASYPPPPPGSSMYNPPPPAPGQATPPPYGVQYAPPP 478 >02_02_0029 + 6204557-6204734,6205105-6205207,6205970-6206108 Length = 139 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 838 PPPPXXXXKXXPPXXGGGXPPXG 906 PPPP + PP GGG P G Sbjct: 38 PPPPFFPPQWAPPVAGGGGPFAG 60 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 839 PPPXKXXXKXXPPXXGGGPPPXXXKXXXXXPPPXXPPXGP 958 P P K K PP G P P K P P P GP Sbjct: 178 PKPPKPGPKPKPPKPGPKPKPKPPK-PGPKPKPKPPKPGP 216 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,051,216 Number of Sequences: 37544 Number of extensions: 940777 Number of successful extensions: 7106 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 1861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5252 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2788108120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -