BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M22 (891 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 7e-08 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 0.57 U42614-1|AAC47143.1| 111|Anopheles gambiae soluble guanylate cy... 23 9.4 U42613-1|AAC47142.1| 111|Anopheles gambiae soluble guanylate cy... 23 9.4 U42612-1|AAC47141.1| 111|Anopheles gambiae soluble guanylate cy... 23 9.4 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 9.4 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 7e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 144 MRECISVHVGQAGVQIGNACWE 209 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 41.1 bits (92), Expect = 4e-05 Identities = 26/68 (38%), Positives = 28/68 (41%) Frame = +1 Query: 199 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTYPVXXXXXXXXXXXXXX 378 P T WS AS+ RCP+TR S ST SS R AST PV Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMRC 78 Query: 379 XXAHTDSC 402 A T SC Sbjct: 79 APARTASC 86 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 462 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 560 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 29.9 bits (64), Expect = 0.11 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 622 DYGKKSKLEFAIYPAPQVSTAVVEPYNS 705 +Y + +++ P+P+VS VVEPYN+ Sbjct: 54 EYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 Score = 28.3 bits (60), Expect = 0.33 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 734 HSDCAFMVDNEAIYDICRR 790 ++D + +DNEA+YDIC R Sbjct: 91 NTDETYCIDNEALYDICFR 109 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 462 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 560 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 29.9 bits (64), Expect = 0.11 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 622 DYGKKSKLEFAIYPAPQVSTAVVEPYNS 705 +Y + +++ P+P+VS VVEPYN+ Sbjct: 54 EYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 Score = 28.3 bits (60), Expect = 0.33 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 734 HSDCAFMVDNEAIYDICRR 790 ++D + +DNEA+YDIC R Sbjct: 91 NTDETYCIDNEALYDICFR 109 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 462 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 560 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 29.9 bits (64), Expect = 0.11 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 622 DYGKKSKLEFAIYPAPQVSTAVVEPYNS 705 +Y + +++ P+P+VS VVEPYN+ Sbjct: 54 EYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 Score = 28.3 bits (60), Expect = 0.33 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 734 HSDCAFMVDNEAIYDICRR 790 ++D + +DNEA+YDIC R Sbjct: 91 NTDETYCIDNEALYDICFR 109 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 462 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 560 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 29.9 bits (64), Expect = 0.11 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 622 DYGKKSKLEFAIYPAPQVSTAVVEPYNS 705 +Y + +++ P+P+VS VVEPYN+ Sbjct: 54 EYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 Score = 28.3 bits (60), Expect = 0.33 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 734 HSDCAFMVDNEAIYDICRR 790 ++D + +DNEA+YDIC R Sbjct: 91 NTDETYCIDNEALYDICFR 109 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect(2) = 0.57 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 250 CPQTRPSGVETILSTLSSARPELAS 324 C RPS ++ ++ S RP+LA+ Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAA 188 Score = 21.8 bits (44), Expect(2) = 0.57 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 193 VMPAGSFTAWSTASSLMARCPQTRPSGV 276 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >U42614-1|AAC47143.1| 111|Anopheles gambiae soluble guanylate cyclase protein. Length = 111 Score = 23.4 bits (48), Expect = 9.4 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = -1 Query: 72 LSGLPNECESNLK 34 +SGLP+ECE++ K Sbjct: 23 VSGLPDECENHAK 35 >U42613-1|AAC47142.1| 111|Anopheles gambiae soluble guanylate cyclase protein. Length = 111 Score = 23.4 bits (48), Expect = 9.4 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = -1 Query: 72 LSGLPNECESNLK 34 +SGLP+ECE++ K Sbjct: 23 VSGLPDECENHAK 35 >U42612-1|AAC47141.1| 111|Anopheles gambiae soluble guanylate cyclase protein. Length = 111 Score = 23.4 bits (48), Expect = 9.4 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = -1 Query: 72 LSGLPNECESNLK 34 +SGLP+ECE++ K Sbjct: 23 VSGLPDECENHAK 35 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.4 bits (48), Expect = 9.4 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = -1 Query: 72 LSGLPNECESNLK 34 +SGLP+ECE++ K Sbjct: 561 VSGLPDECENHAK 573 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 921,297 Number of Sequences: 2352 Number of extensions: 19404 Number of successful extensions: 50 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -