BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M21 (885 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 7.1 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.4 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 7.1 Identities = 10/35 (28%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 267 TCTTPVWAAYTRSDYSTFNVPYALY--SSPSSGFH 365 T P W Y + + + VP+ Y P FH Sbjct: 55 TLVLPPWVEYRKGEVRSIQVPFDTYFQVGPLQAFH 89 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 9.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 867 EKVPLISGPTPNTTIGAYLSKQGF 796 EK+P ++ P+ NT L++ GF Sbjct: 322 EKMPRLNPPSSNTIQSELLARSGF 345 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 884,252 Number of Sequences: 2352 Number of extensions: 18120 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -