BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M21 (885 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK094921-1|BAC04456.1| 128|Homo sapiens protein ( Homo sapiens ... 32 3.2 BC032586-1|AAH32586.1| 363|Homo sapiens MXD3 protein protein. 31 5.6 >AK094921-1|BAC04456.1| 128|Homo sapiens protein ( Homo sapiens cDNA FLJ37602 fis, clone BRCOC2009380. ). Length = 128 Score = 31.9 bits (69), Expect = 3.2 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = -1 Query: 843 PTPNTTIGAYLSKQGFSGVLSSIGSISEWLDVNPQWPPLSAPCWRGRLSSVASE 682 P+P+ T G + +QG S + ++ S +EWLD PP + P RL S +E Sbjct: 31 PSPSRTAG-WRGEQGASWTVEAL-SATEWLDRGCVPPPAAGPGIPARLGSAGAE 82 >BC032586-1|AAH32586.1| 363|Homo sapiens MXD3 protein protein. Length = 363 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -2 Query: 371 PIVKSRGWR*VQRIWHIESAVIASGICGPHRS-RTRTPAAPG 249 P+ R WR + R W + G P RS TRT AAPG Sbjct: 190 PLPAQRSWRWMWRAWCLGVRPSCCGASSPARSTATRTAAAPG 231 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,368,323 Number of Sequences: 237096 Number of extensions: 2691988 Number of successful extensions: 10412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10397 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11326166088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -