BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M18 (897 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|S... 28 1.6 SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosacch... 28 2.1 SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr ... 26 8.4 SPBC4B4.04 |||translation initiation factor eIF2A |Schizosacchar... 26 8.4 >SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 383 VSRDIRTTTEARRPGTARNTRRPK 312 V+R +RT+T RRP T R+PK Sbjct: 21 VARKVRTSTTFRRPKTLELARKPK 44 >SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -2 Query: 383 VSRDIRTTTEARRPGTARNTRRPK 312 V++ +RT+T RRP T + +R+PK Sbjct: 21 VAKKVRTSTTFRRPKTLQLSRKPK 44 >SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.8 bits (54), Expect = 8.4 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -3 Query: 691 HHVVVHNSLPTYNCVLGEINLELNFNGVLVLALQ 590 H V+ NS+ ++ + +ELN++ V V L+ Sbjct: 239 HESVLRNSMDDFHTAISSSEIELNYSNVSVSTLK 272 >SPBC4B4.04 |||translation initiation factor eIF2A |Schizosaccharomyces pombe|chr 2|||Manual Length = 576 Score = 25.8 bits (54), Expect = 8.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 391 AEP*AGTSGPPQRPGAQAQRETLGVRSRQS*ALAAGSAQR 272 A+P +G + PGA+ Q T R + +++GSA + Sbjct: 440 AKPSVKPAGAYRPPGARGQNSTFSYRREEIDVMSSGSANK 479 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,168,188 Number of Sequences: 5004 Number of extensions: 58106 Number of successful extensions: 168 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -