Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_M18
         (897 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ139945-1|ABA29466.1|  399|Anopheles gambiae protein O-fucosylt...    23   9.5  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    23   9.5  

>DQ139945-1|ABA29466.1|  399|Anopheles gambiae protein
           O-fucosyltransferase 1 protein.
          Length = 399

 Score = 23.4 bits (48), Expect = 9.5
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 495 APALWPAAPRVS 530
           AP+LWP A R+S
Sbjct: 102 APSLWPPAERIS 113


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 23.4 bits (48), Expect = 9.5
 Identities = 10/35 (28%), Positives = 18/35 (51%)
 Frame = -1

Query: 390 QSREQGHQDHHRGPAPRHSEKHSASEADRAERLLP 286
           Q ++Q H  HH     +   K++    + +ER+LP
Sbjct: 779 QQQQQQHHHHHLQQQQQIVGKNTLYSRNSSERMLP 813


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 854,174
Number of Sequences: 2352
Number of extensions: 16108
Number of successful extensions: 72
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 69
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 72
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 96747534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)