BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M16 (885 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.10c |stg1||SM22/transgelin-like actin modulating protein... 26 8.2 SPAPB1A10.14 |||F-box protein, unnamed|Schizosaccharomyces pombe... 26 8.2 >SPAC4F8.10c |stg1||SM22/transgelin-like actin modulating protein Stg1|Schizosaccharomyces pombe|chr 1|||Manual Length = 174 Score = 25.8 bits (54), Expect = 8.2 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 644 RTLPNSERGSGGDAADSAPRVTRAQQ*QQAECTIASLVY 528 + P RG G A+ PRV AQQ ++ + SL Y Sbjct: 110 KMFPGKVRGLGPKLAEKKPRVFSAQQQREFREGVNSLQY 148 >SPAPB1A10.14 |||F-box protein, unnamed|Schizosaccharomyces pombe|chr 1|||Manual Length = 243 Score = 25.8 bits (54), Expect = 8.2 Identities = 9/43 (20%), Positives = 23/43 (53%) Frame = +2 Query: 122 IYYETQQTRKNSLILNXXK*LVKFXPLHNISSTKYVTYSITSI 250 + ++ QQT L + ++++ P H++ + + +Y +T I Sbjct: 22 VNFDAQQTSSTLLPVEVIDSVMQYLPAHDVIQSSFASYPLTLI 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,580,245 Number of Sequences: 5004 Number of extensions: 42905 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 444486180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -