Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_M15
         (919 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q44068 Cluster: Alpha-hemolysin; n=2; root|Rep: Alpha-h...    40   0.067

>UniRef50_Q44068 Cluster: Alpha-hemolysin; n=2; root|Rep:
           Alpha-hemolysin - Aeromonas hydrophila
          Length = 59

 Score = 40.3 bits (90), Expect = 0.067
 Identities = 24/46 (52%), Positives = 25/46 (54%)
 Frame = +1

Query: 364 PXXRSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501
           P   S A SLTD  RSVVR+    S  S AV  L TES DN   NM
Sbjct: 14  PHQPSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 59


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 352,485,119
Number of Sequences: 1657284
Number of extensions: 2562397
Number of successful extensions: 1892
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1871
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1892
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 84031265255
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)