BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M15 (919 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 52 5e-07 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 42 7e-04 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 41 0.001 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 40 0.002 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 40 0.003 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 40 0.004 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 39 0.005 SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 39 0.005 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 36 0.061 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.061 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 31 1.3 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 31 1.3 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/65 (43%), Positives = 34/65 (52%) Frame = -1 Query: 589 DARKXVGXXXHTXAXRPXXXXWXFGGLLXTCSXVRYRVIXXITXXPXLSEXMXXSXSXRP 410 D + G T A RP W F GLL TCS +RY +I IT P LSE + + + RP Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 Query: 409 SAXXQ 395 SA Q Sbjct: 79 SAASQ 83 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 54.0 bits (124), Expect = 2e-07 Identities = 27/59 (45%), Positives = 32/59 (54%) Frame = -1 Query: 571 GXXXHTXAXRPXXXXWXFGGLLXTCSXVRYRVIXXITXXPXLSEXMXXSXSXRPSAXXQ 395 G T A RP W F GLL TCS +RY +I IT P LSE + + + RPSA Q Sbjct: 761 GAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ 819 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.0 bits (124), Expect = 2e-07 Identities = 27/59 (45%), Positives = 32/59 (54%) Frame = -1 Query: 571 GXXXHTXAXRPXXXXWXFGGLLXTCSXVRYRVIXXITXXPXLSEXMXXSXSXRPSAXXQ 395 G T A RP W F GLL TCS +RY +I IT P LSE + + + RPSA Q Sbjct: 3 GAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ 61 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 54.0 bits (124), Expect = 2e-07 Identities = 27/59 (45%), Positives = 32/59 (54%) Frame = -1 Query: 571 GXXXHTXAXRPXXXXWXFGGLLXTCSXVRYRVIXXITXXPXLSEXMXXSXSXRPSAXXQ 395 G T A RP W F GLL TCS +RY +I IT P LSE + + + RPSA Q Sbjct: 26 GAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ 84 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 54.0 bits (124), Expect = 2e-07 Identities = 27/59 (45%), Positives = 32/59 (54%) Frame = -1 Query: 571 GXXXHTXAXRPXXXXWXFGGLLXTCSXVRYRVIXXITXXPXLSEXMXXSXSXRPSAXXQ 395 G T A RP W F GLL TCS +RY +I IT P LSE + + + RPSA Q Sbjct: 408 GAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ 466 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 54.0 bits (124), Expect = 2e-07 Identities = 27/59 (45%), Positives = 32/59 (54%) Frame = -1 Query: 571 GXXXHTXAXRPXXXXWXFGGLLXTCSXVRYRVIXXITXXPXLSEXMXXSXSXRPSAXXQ 395 G T A RP W F GLL TCS +RY +I IT P LSE + + + RPSA Q Sbjct: 3 GAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAKQ 61 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/59 (45%), Positives = 32/59 (54%) Frame = -1 Query: 580 KXVGXXXHTXAXRPXXXXWXFGGLLXTCSXVRYRVIXXITXXPXLSEXMXXSXSXRPSA 404 K G T A RP W F GLL TCS +RY +I IT P LSE + + + RPSA Sbjct: 554 KGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 612 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 52.4 bits (120), Expect = 5e-07 Identities = 33/68 (48%), Positives = 34/68 (50%) Frame = -3 Query: 575 GRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFERXDXXIXIRTTERXXS 396 GR + S A R LAF P HMF LS DSV TAFER D R ER S Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIARSSRMHERRES 61 Query: 395 VSEXAXER 372 VSE A ER Sbjct: 62 VSEEAEER 69 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFERXD 435 G GGR + S A R LAF P HMF LS DSV N TAFE D Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF R LS D V N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = -3 Query: 584 SEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 + GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 57 NSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNMXPXGR 516 RS A SLTD RSVVR+ S S AV L TES DN NM G+ Sbjct: 13 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNMRLYGK 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = -3 Query: 578 GGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 GGR + S A R LAF P HMF LS DSV N TAFE Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/77 (38%), Positives = 36/77 (46%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNMXPXGRQXAXXRXMAXLL 552 RS A SLTD RSVVR+ S S AV L TES DN N+ + + + L Sbjct: 315 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNISCEIQLFSVHQKSVTKL 374 Query: 553 XYVXTLRPPSEHPXXDP 603 + T PP H DP Sbjct: 375 DTIVTSTPP-WHVTFDP 390 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/49 (46%), Positives = 25/49 (51%) Frame = -3 Query: 590 GCSEGGRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 G GGR + S A R LAF P HMF LS DSV N TAF+ Sbjct: 13 GQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN NM Sbjct: 59 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN NM Sbjct: 581 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN NM Sbjct: 8 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN NM Sbjct: 146 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/56 (42%), Positives = 27/56 (48%) Frame = +1 Query: 334 IRXXTRXGXWPXXRSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 + R W S A SLTD RSVVR+ S S AV L TES DN N+ Sbjct: 54 VNELNRLPSWAKKISSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 109 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -3 Query: 575 GRXVXTYXSKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 GR + S A R LAF P HMF LS DSV N TAFE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = +1 Query: 346 TRXGXWPXXRSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 T G RS A SLTD RSVVR+ S S AV L TES DN N+ Sbjct: 33 TGGGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 84 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/81 (35%), Positives = 36/81 (44%), Gaps = 4/81 (4%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXN----MXPXGRQXAXXRXM 540 RS A SLTD RSVVR+ S S AV L TES DN N + P + Sbjct: 8 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNIDAEVLPLHFPVVGNLKL 67 Query: 541 AXLLXYVXTLRPPSEHPXXDP 603 A L+ ++ + R P P Sbjct: 68 ADLIDFLCSTRSSGRIPNRQP 88 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN N+ Sbjct: 454 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 496 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN N+ Sbjct: 8 RSSASSLTDSLRSVVRLRRAESAHSKAVIRLSTESGDNAGKNI 50 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN N+ Sbjct: 215 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 257 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXNM 501 RS A SLTD RSVVR+ S S AV L TES DN N+ Sbjct: 269 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 311 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXN 498 RS A SLTD RSVVR+ S S AV L TES DN N Sbjct: 260 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 301 >SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXN 498 RS A SLTD RSVVR+ S S AV L TES DN N Sbjct: 5 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 46 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = +1 Query: 373 RSXAXSLTDXXRSVVRMXIXXSXRSXAVXXLXTESRDNXRXN 498 RS A SLTD RSVVR+ S S AV L TES DN N Sbjct: 75 RSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 116 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -3 Query: 551 SKXAIXRXLAFWRPXGHMFXRXLSRDSVXNXXTAFE 444 S A R LAF P HMF LS DSV N TAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 35.5 bits (78), Expect = 0.061 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 314 RXYXIXXSAXARGXAXGLSXAXXLXHSLTPXARSXGXGXRHPLAQXR 454 R I SA ARG A + A L SLT ARS G G R+ L Q R Sbjct: 97 RASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 35.5 bits (78), Expect = 0.061 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 314 RXYXIXXSAXARGXAXGLSXAXXLXHSLTPXARSXGXGXRHPLAQXR 454 R I SA ARG A + A L SLT ARS G G R+ L Q R Sbjct: 461 RASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 3/80 (3%) Frame = +2 Query: 473 NHAITXXXTCXQXAAKXPXXXXWPXCXRMXXXSDXLPS---IXTXILSSXVXKAXRXIKI 643 N IT TC Q A+K P P C R S L S I + + + + Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 Query: 644 LPXSPXXLALXLSXCXPADT 703 P AL C DT Sbjct: 146 FPLEAPSCALLFRPCRLPDT 165 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 3/80 (3%) Frame = +2 Query: 473 NHAITXXXTCXQXAAKXPXXXXWPXCXRMXXXSDXLPS---IXTXILSSXVXKAXRXIKI 643 N IT TC Q A+K P P C R S L S I + + + + Sbjct: 115 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 174 Query: 644 LPXSPXXLALXLSXCXPADT 703 P AL C DT Sbjct: 175 FPLEAPSCALLFRPCRLPDT 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,147,411 Number of Sequences: 59808 Number of extensions: 89863 Number of successful extensions: 139 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2657535823 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -