BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M12 (917 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 4.2 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 5.6 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 4.2 Identities = 9/46 (19%), Positives = 25/46 (54%) Frame = +3 Query: 102 TALQKMVGNNEVELSEAEAEQYDRQIRLWGLDSQKRLRAAKVLIIG 239 T ++G++ ++ + D+Q+ LW ++R++ + +I+G Sbjct: 543 TTFSNIIGSSGPSVTSCTGSEIDKQVGLW----ERRVKGLRRMILG 584 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 24.2 bits (50), Expect = 5.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 684 RKKCPRNSFYNSKTSSYI 737 R+KCP+ Y KT +YI Sbjct: 533 RRKCPKTLSYLLKTKTYI 550 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 885,243 Number of Sequences: 2352 Number of extensions: 17613 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99641691 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -