SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_M09
         (895 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8IBE6 Cluster: Putative uncharacterized protein MAL7P1...    35   2.4  

>UniRef50_Q8IBE6 Cluster: Putative uncharacterized protein
           MAL7P1.178; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein MAL7P1.178 - Plasmodium
           falciparum (isolate 3D7)
          Length = 613

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 407 NKKHSANKSVIQKI--DNNLLRFMFFFKS*LIYETE*YCSVCNLEETCNLPKRIL 565
           N ++ +NK   +K   DNN+L F    K   +Y+   YCS C L + CN  KR +
Sbjct: 168 NSENVSNKKDFRKPMDDNNVLLFTESDKDNDVYKNLYYCSKCGLSKYCNCGKRTM 222


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 667,573,651
Number of Sequences: 1657284
Number of extensions: 12723082
Number of successful extensions: 22801
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 22048
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22800
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 80751996367
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -