Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_M09
         (895 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    25   0.80 
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    21   9.9  

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 25.0 bits (52), Expect = 0.80
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = -2

Query: 681 CTIYKNLRRRNNNLSIKTYRRLFFLKQQLVH 589
           CT+ + ++R NN  S+  Y R+FF    +VH
Sbjct: 508 CTVLR-VQRFNNYQSLAHYLRVFFTVFNVVH 537


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 9.9
 Identities = 6/10 (60%), Positives = 10/10 (100%)
 Frame = -3

Query: 212 NFSRKCWYLR 183
           NF++KC++LR
Sbjct: 50  NFTKKCYFLR 59


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,984
Number of Sequences: 336
Number of extensions: 3890
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24823920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)