BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M09 (895 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 30 2.9 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) Length = 129 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 5/66 (7%) Frame = -1 Query: 202 ENVGTCGTLAHRRFINFWYSTNE-----PFCYTIL*NKKNTTMLYKSLKQINYIQVKTKS 38 E + C H R +N WY E P C ++ T Y ++K I+ + ++ Sbjct: 15 ETINCCKQPMHHRCLNDWYKVQEYRGLLPTCPHCRKGREQQTRAYPTIKLIDTVDLEGGP 74 Query: 37 *GFPIV 20 G P+V Sbjct: 75 VGKPVV 80 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -1 Query: 283 ILLFSGCMMLLFHRGHHA*ARIELISRENVGTCGTLAHRRFINFWYSTNE 134 +++ SGC + GH E++S E++ T G +R F+ N+ Sbjct: 349 MIVDSGCQYFIIREGHALKPSKEILSLESICTPGYFVVQRNFRFYLEKND 398 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,712,481 Number of Sequences: 59808 Number of extensions: 396710 Number of successful extensions: 603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -