BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M06 (923 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory pro... 22 5.9 AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical pro... 22 5.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.9 >DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory protein 2 protein. Length = 122 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 152 RFCFRGRPVAIYK-IKHGLEPRNSDWIRVVS 241 R C + V++ K I+ ++ RNSDW +++S Sbjct: 73 RKCNDHQKVSVEKVIRFLIKERNSDWQQLIS 103 >AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical protein protein. Length = 122 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 152 RFCFRGRPVAIYK-IKHGLEPRNSDWIRVVS 241 R C + V++ K I+ ++ RNSDW +++S Sbjct: 73 RKCNDHQKVSVEKVIRFLIKERNSDWQQLIS 103 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 504 HMGWHIIRSLAKSGGK 457 H HI+RS+ +SGG+ Sbjct: 572 HYKEHIMRSITESGGR 587 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,189 Number of Sequences: 336 Number of extensions: 3784 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25858250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -