BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M06 (923 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-tran... 25 2.5 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 25 4.3 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 5.7 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 7.5 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 9.9 >AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-transferase E4 protein. Length = 225 Score = 25.4 bits (53), Expect = 2.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 179 AIYKIKHGLEPRNSDWIRVVSKEAEFEAT 265 AI+ I G PR + W++ ++K +EAT Sbjct: 173 AIFPIDAGKYPRLAGWVKRLAKLPYYEAT 201 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 24.6 bits (51), Expect = 4.3 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 527 EEPRKHAFTWAGISSGPSPRVAVR 456 EE ++H F W GP + +R Sbjct: 424 EEAKRHPFAWTPFGEGPRVCIGLR 447 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.2 bits (50), Expect = 5.7 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 294 EILKQVPELSQFAVGLCHIQIMHTSASLALNESWDPNVRDDMEMM 428 E L + + +QF LC + H S + L E D D +E M Sbjct: 411 EGLPDIGDFTQFWANLCEKPVQHNSEGMRLAE--DERFSDGIEDM 453 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.8 bits (49), Expect = 7.5 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -1 Query: 692 LEHDAADTGDSGESRRQPDSVTTIFRLPA*FLCSHSQTPCH 570 L H A G G+S P S FR C+ + CH Sbjct: 939 LMHTAVGHGGGGQSLSGPGSCLEDFRATPFIECNGGKGHCH 979 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.4 bits (48), Expect = 9.9 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +2 Query: 191 IKHGLEPRNSDWIRVVSKEAEFEATAPGRAPRHRG 295 +KH E + +DW+ + + A + +A +H G Sbjct: 34 LKHVPEEQIADWLCIAEQGASYNGSAVNARFKHYG 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 731,042 Number of Sequences: 2352 Number of extensions: 15513 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100468593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -