BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M06 (923 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical... 29 3.6 AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical ... 29 3.6 U39647-6|AAM51529.1| 505|Caenorhabditis elegans Twik family of ... 29 4.7 AF083649-1|AAC32860.1| 381|Caenorhabditis elegans putative pota... 29 4.7 U85766-1|AAD00574.1| 216|Caenorhabditis elegans EGL-17 protein. 28 8.2 AC006635-3|AAK68384.1| 216|Caenorhabditis elegans Egg laying de... 28 8.2 >AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 328 NCDSSGTCFRISSVTRCTPRCCGL 257 NC++ GTC R++ RC P G+ Sbjct: 1387 NCENGGTCDRLTGQCRCLPGFTGM 1410 >AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 328 NCDSSGTCFRISSVTRCTPRCCGL 257 NC++ GTC R++ RC P G+ Sbjct: 1387 NCENGGTCDRLTGQCRCLPGFTGM 1410 >U39647-6|AAM51529.1| 505|Caenorhabditis elegans Twik family of potassium channelsprotein 17, isoform a protein. Length = 505 Score = 29.1 bits (62), Expect = 4.7 Identities = 26/98 (26%), Positives = 37/98 (37%) Frame = -1 Query: 617 RLPA*FLCSHSQTPCHVPKLSFPSVMGIVSEEPRKHAFTWAGISSGPSPRVAVR*TLWHY 438 RLP L S P H S +G V E GI P + VR +W Sbjct: 19 RLPFSDLAFVSSLPEHYLPQSLKENIGRVKWEEYNRR---EGIEDVPEQPIVVRVPIWRR 75 Query: 437 LVEHHFHVIPHIRIPTLI*SKTRRSVHYLYMTEADREL 324 +++ ++PH+ + L+ S EAD EL Sbjct: 76 ILKLLKILLPHVGLNVLLLSYIAMGATVFIWLEADHEL 113 >AF083649-1|AAC32860.1| 381|Caenorhabditis elegans putative potassium channel subunitn2P17m3 protein. Length = 381 Score = 29.1 bits (62), Expect = 4.7 Identities = 26/98 (26%), Positives = 37/98 (37%) Frame = -1 Query: 617 RLPA*FLCSHSQTPCHVPKLSFPSVMGIVSEEPRKHAFTWAGISSGPSPRVAVR*TLWHY 438 RLP L S P H S +G V E GI P + VR +W Sbjct: 19 RLPFSDLAFVSSLPEHYLPQSLKENIGRVKWEEYNRR---EGIEDVPEQPIVVRVPIWRR 75 Query: 437 LVEHHFHVIPHIRIPTLI*SKTRRSVHYLYMTEADREL 324 +++ ++PH+ + L+ S EAD EL Sbjct: 76 ILKLLKILLPHVGLNVLLLSYIAMGATVFIWLEADHEL 113 >U85766-1|AAD00574.1| 216|Caenorhabditis elegans EGL-17 protein. Length = 216 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 161 FRGRPVAIYKIKHGLEPRNSDWIRVVSKEAEFEATAPGRAPRHRGDP 301 F GR + + L+PR DWI++V AE E + P+ + P Sbjct: 133 FNGRGRFQNPLSYHLKPRCFDWIKLVRYVAESEKSVCSTPPKPKLSP 179 >AC006635-3|AAK68384.1| 216|Caenorhabditis elegans Egg laying defective protein 17 protein. Length = 216 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 161 FRGRPVAIYKIKHGLEPRNSDWIRVVSKEAEFEATAPGRAPRHRGDP 301 F GR + + L+PR DWI++V AE E + P+ + P Sbjct: 133 FNGRGRFQNPLSYHLKPRCFDWIKLVRYVAESEKSVCSTPPKPKLSP 179 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,917,777 Number of Sequences: 27780 Number of extensions: 352279 Number of successful extensions: 868 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2370744068 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -