BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M06 (923 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21065.1 68414.m02635 expressed protein 94 1e-19 >At1g21065.1 68414.m02635 expressed protein Length = 217 Score = 94.3 bits (224), Expect = 1e-19 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 3/88 (3%) Frame = +3 Query: 225 GSAWFQRKLNLRPQHRGVHLVTEEILKQVPE-LSQFAVGLCHIQIMHTSASLALNESWDP 401 G+ W Q+ + L P RG HL+T +ILK++ E LS F GL H+ + HTSASL +NE++DP Sbjct: 75 GAKWAQKTITLPPLRRGCHLITPKILKEIREDLSDFNCGLAHVFLQHTSASLTINENYDP 134 Query: 402 NVRDDMEMMLNKIVPEG--LPYRHSWRG 479 +V+ D E LN+IVPEG P+RH+ G Sbjct: 135 DVQADTETFLNRIVPEGNSAPWRHTMEG 162 Score = 93.5 bits (222), Expect = 2e-19 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = +1 Query: 475 EGPDDMPAHVKACFLGSSLTIPITDGKLNLGTWQGVWLCEHRNHAGSRKIVVTLSG 642 EGPDDMPAH+K+ G LTIPIT GKL++GTWQG+WLCEHR+ +R++VVTL+G Sbjct: 161 EGPDDMPAHIKSSMFGCQLTIPITKGKLSMGTWQGIWLCEHRDAPTARRVVVTLNG 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,940,955 Number of Sequences: 28952 Number of extensions: 324258 Number of successful extensions: 775 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2197951248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -