BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M04 (895 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 25 3.1 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 25 3.1 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 25 3.1 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 25 3.1 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 24 5.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.5 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 9.5 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.5 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.5 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 25.0 bits (52), Expect = 3.1 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 648 SRPRVFPTVVNFYCFGALI*LLRQLGRDGAASVQ 547 S+ R+ ++ YC GA+ + +LG DG A ++ Sbjct: 30 SKMRLMFGLITSYCDGAVRTIRSELGADGTAELE 63 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 25.0 bits (52), Expect = 3.1 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 648 SRPRVFPTVVNFYCFGALI*LLRQLGRDGAASVQ 547 S+ R+ ++ YC GA+ + +LG DG A ++ Sbjct: 30 SKMRLMFGLITSYCDGAVRTIRSELGADGTAELE 63 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 25.0 bits (52), Expect = 3.1 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 648 SRPRVFPTVVNFYCFGALI*LLRQLGRDGAASVQ 547 S+ R+ ++ YC GA+ + +LG DG A ++ Sbjct: 30 SKMRLMFGLITSYCDGAVRTIRSELGADGTAELE 63 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 25.0 bits (52), Expect = 3.1 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 648 SRPRVFPTVVNFYCFGALI*LLRQLGRDGAASVQ 547 S+ R+ ++ YC GA+ + +LG DG A ++ Sbjct: 150 SKMRLMFGLITSYCDGAVRTIRSELGADGTAELE 183 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 24.2 bits (50), Expect = 5.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 648 SRPRVFPTVVNFYCFGALI*LLRQLGRDGAASVQ 547 S+ R+ ++ YC GA+ + +LG DG A ++ Sbjct: 30 SKMRLMFGLLTSYCDGAVRTIRSELGADGTAELE 63 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 597 EPQSNRSSLQLGTRGADSAPT 659 EP+S S GT GA +APT Sbjct: 1501 EPESGVSEAPPGTDGAAAAPT 1521 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.4 bits (48), Expect = 9.5 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 494 LRAFYGQCHSEVLVLVTPWTDAAPSRPNCLKSQMR 598 ++ F G + +L + WT A + NCL + +R Sbjct: 719 IKLFAGDVNRSRQLLASHWTAANQQQLNCLHAAIR 753 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 9.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 624 VVNFYCFGALI*LLRQLGRDGAASVQ 547 ++ YC GA+ + +LG DG A ++ Sbjct: 38 LITSYCDGAVRTIRSELGADGTAELE 63 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 9.5 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 648 SRPRVFPTVVNFYCFGALI*LLRQLGRDGAASVQ 547 S+ R+ ++ YC GA+ + +LG DG ++ Sbjct: 30 SKMRLMFGLITSYCDGAVRTIRSELGADGTTELE 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,836 Number of Sequences: 2352 Number of extensions: 8538 Number of successful extensions: 26 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -