BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M04 (895 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42750.1 68418.m05206 expressed protein 29 5.5 At1g70900.1 68414.m08181 expressed protein 28 7.3 >At5g42750.1 68418.m05206 expressed protein Length = 337 Score = 28.7 bits (61), Expect = 5.5 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +3 Query: 39 LKILVSLPVARRTRTVKQLPSLTL*LYIKIRTIMSTNENNSEVAVDKVGDENKGD 203 L +L LPV+ RT T TL + + + N NN+E A+ + E K D Sbjct: 96 LHLLSHLPVSPRTSTGSYNDGFTLPVKDILPDQPTNNNNNTENAITNISTEAKDD 150 >At1g70900.1 68414.m08181 expressed protein Length = 244 Score = 28.3 bits (60), Expect = 7.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 210 FWRHLYSHRRPCQRPLHCYFH 148 F ++ R PC RP+HC H Sbjct: 50 FIERVWQQRPPCLRPIHCSIH 70 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,491,227 Number of Sequences: 28952 Number of extensions: 178836 Number of successful extensions: 384 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -