BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M02 (866 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; ... 47 5e-04 UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; ... 46 0.002 UniRef50_Q8ID63 Cluster: Putative uncharacterized protein MAL13P... 33 9.4 >UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 47 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -1 Query: 251 LKLEGGWTDLANFGLELFVEVQRRFK 174 LKLE GWTDLANFGLEL VEVQR K Sbjct: 20 LKLENGWTDLANFGLELPVEVQRGLK 45 >UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 77 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +3 Query: 72 LKTNKRIRPTGDTSKRKQNCYFYLI 146 LK K IR TGDTSK KQNCYFYLI Sbjct: 46 LKQTKGIRQTGDTSKEKQNCYFYLI 70 Score = 35.5 bits (78), Expect = 1.8 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 43 KRPKLLYNINLKQTKGFVRQGTHQRENK 126 KRPK LY INLKQTKG + G +E + Sbjct: 36 KRPKHLYKINLKQTKGIRQTGDTSKEKQ 63 >UniRef50_Q8ID63 Cluster: Putative uncharacterized protein MAL13P1.323; n=2; Plasmodium|Rep: Putative uncharacterized protein MAL13P1.323 - Plasmodium falciparum (isolate 3D7) Length = 3265 Score = 33.1 bits (72), Expect = 9.4 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = -1 Query: 755 LRTLSFDRKYFLECLNTLLCEKLFYFLLHIHTIDIFVLQFNEN 627 L+ +F++ Y LE L EK FY + ++ + IFV + N+N Sbjct: 2309 LKKFNFNKIYNLETFKELKLEKKFYENIELYLLSIFVFEKNKN 2351 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,975,160 Number of Sequences: 1657284 Number of extensions: 11017926 Number of successful extensions: 23334 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23330 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 77062818868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -