BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M02 (866 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H3.06 |apl6||AP-3 adaptor complex subunit Apl6 |Schizosacc... 30 0.49 SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|... 26 8.0 >SPAC23H3.06 |apl6||AP-3 adaptor complex subunit Apl6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 745 Score = 29.9 bits (64), Expect = 0.49 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -2 Query: 829 SHLFNFTLSFILVDIKLDILDKARHYE 749 S LFN+ LS I D+ D+ D+AR Y+ Sbjct: 525 SLLFNYVLSLIHFDMSYDLRDRARFYK 551 >SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1402 Score = 25.8 bits (54), Expect = 8.0 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 341 HALGIYTHLSFAFVIHNTVK*NTSRNI*NNFFXKCICYLYNL 466 +A+G + LS ++H N + NNFF K + + + L Sbjct: 1043 YAIGQFRFLSKLVLVHGRWDYNRVAEMVNNFFYKSVVWTFTL 1084 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,891,008 Number of Sequences: 5004 Number of extensions: 53202 Number of successful extensions: 128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 432473040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -