BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L23 (892 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1 |Sc... 27 4.7 SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces... 27 4.7 SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizos... 27 4.7 SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 6.3 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 26 8.3 SPAC18B11.02c |||pseudouridylate synthase |Schizosaccharomyces p... 26 8.3 SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pomb... 26 8.3 >SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 762 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 432 LGRALDVLPRLFQSLLGLAVRVSERXPGDSW 340 +G + L RLF SL GL ++ PG+ W Sbjct: 410 VGTVIQGLSRLFSSLYGLRFVPADISPGEVW 440 >SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces pombe|chr 2|||Manual Length = 1485 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 177 DAPDFFKDIEHHTKEFHKTLEQ--QFNSLTKSKDAQDFSKAW 296 D +F D++ H K FH E+ + + +K D K W Sbjct: 665 DMKSYFSDLDRHMKYFHAMQEKDAELIEMAFAKKKADVRKEW 706 >SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 899 Score = 26.6 bits (56), Expect = 4.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 171 RRDAPDFFKDIEHHTKEFHKTLEQQFNSLT 260 ++ DFFK + ++ H TL ++ NSL+ Sbjct: 56 KKSEQDFFKMLSSRDRDAHSTLRKRSNSLS 85 >SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 412 Score = 26.2 bits (55), Expect = 6.3 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +3 Query: 84 PHSVSRQYIMAAKFVVLFACIALAQGAMVRRDAPDFFKDIEHHTKEFHKTLEQQFNSLTK 263 P S S + A + L + V R F + +EH+ K+LE+Q + L + Sbjct: 171 PSSSSCNLVNANSLDIYLNINNLKKSKSVPRLRGQFMEPVEHN-HPLSKSLEEQSSFLEQ 229 Query: 264 SKDA 275 SKDA Sbjct: 230 SKDA 233 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 25.8 bits (54), Expect = 8.3 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = +2 Query: 542 KVSSNVQET--NEKLAPKIKAAYD 607 +V N++ET EK A K+KA+YD Sbjct: 299 EVDLNIEETVLKEKYADKVKASYD 322 >SPAC18B11.02c |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 25.8 bits (54), Expect = 8.3 Identities = 16/64 (25%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +3 Query: 141 CIALAQGAMVRRDAPDFFKDIEHHTKEFH-KTLEQQFNSLTKSKDAQDFSKAWKDGSESV 317 C + +G +RR P +++ I ++ KTL + FN+ + +++ + KA ++G V Sbjct: 13 CEYVFKGDGLRRVPPYYYEYITFAKLRWYGKTLLEVFNTEFRDRESGYYEKAIRNGQVKV 72 Query: 318 LQQL 329 Q+ Sbjct: 73 NNQI 76 >SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 631 Score = 25.8 bits (54), Expect = 8.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -1 Query: 409 ASTVPKPPWPCRSRLRALPWRLLAKALSCCSTDSEPSFQAL 287 AST+ K PWP + L +P + + CS+ +E ++ + Sbjct: 38 ASTLEKEPWPASTALLVMPG---GRDMGYCSSFNETIYRKI 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,204,711 Number of Sequences: 5004 Number of extensions: 37159 Number of successful extensions: 146 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -