BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L22 (950 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 26 0.49 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 24 2.0 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.8 bits (54), Expect = 0.49 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -1 Query: 317 EPMLVIRSRTLMPSKALANRPGQYGSTSTAAAFKMVEIFSPVTATSSSTRMRAE*T 150 +P VI + T PS L+NR G+ A+ P T+T++ T + + T Sbjct: 123 KPSGVISTNTSPPSPILSNRFGENEEADAASNVISSTPLPPTTSTTTRTTLTTKFT 178 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.8 bits (49), Expect = 2.0 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Frame = +1 Query: 115 KLKMVSKAELACVYSALILVDD--------DVAVTGEKISTILKAAAVDVEPYWPGLFAK 270 ++KM K EL C+ + ++ D +V + EKI +L+ P PG FAK Sbjct: 305 EMKM-DKTELGCLRAIILYNPDVRGIKSVQEVEMLREKIYGVLEEYTRTTHPNEPGRFAK 363 Query: 271 AL 276 L Sbjct: 364 LL 365 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,399 Number of Sequences: 336 Number of extensions: 2027 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26789147 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -