BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L21 (978 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1006.07 |||translation initiation factor eIF4A|Schizosacchar... 28 1.7 SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pom... 26 7.0 >SPAC1006.07 |||translation initiation factor eIF4A|Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 28.3 bits (60), Expect = 1.7 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +2 Query: 335 AIDLLTNDECRLLLEVEDFFN 397 +I+ +TND+ R++ E+E F+N Sbjct: 358 SINFVTNDDVRMMREIEQFYN 378 >SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 26.2 bits (55), Expect = 7.0 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = +1 Query: 97 FKCNFAITMGF*YLIVCTPACAFTHN-IKMLAKMAPS-QDKLVHLHKTPTSLDINPSGLL 270 F C I++ F I A A H I L + P +D H K I+P LL Sbjct: 310 FVCPSCISLDFDLQI---QAFARQHRVISTLGVVYPEREDSCFHKIKAAQWHQISPRSLL 366 Query: 271 FAFVELNHYNNECESEGVMGCGHRF 345 F F E NH +++ ++ G ++ Sbjct: 367 FQFQEQNHIHHKKIRRKLLAAGWKW 391 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,779,914 Number of Sequences: 5004 Number of extensions: 47138 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 503290872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -