Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_L21
         (978 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    25   3.4  

>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
           channel alpha subunitprotein.
          Length = 2139

 Score = 25.0 bits (52), Expect = 3.4
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +2

Query: 476 PSPXELKPS-PAELANDLLQQLDSXGKXENIFFXLVRGK 589
           P P  ++ S P ELA+  L+ +DS    +  F  + +GK
Sbjct: 83  PVPVRMQGSFPPELASTPLEDIDSFYSNQRTFVVISKGK 121


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 733,533
Number of Sequences: 2352
Number of extensions: 12225
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 65
effective length of database: 411,099
effective search space used: 106885740
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)