BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L21 (978 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 5.6 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 7.3 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.6 bits (46), Expect = 5.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 436 CSARKVYKQITIIIEEILNFEQQTALIVSEQID 338 CS V IT + + + F ++ AL +SE ++ Sbjct: 135 CSVNDVNMTITELTDPVKEFWERRALQISEGVE 167 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 7.3 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +3 Query: 159 CLHAQYKNACQNGALTGQVSPSSQNTNIIRHQSLW---TFIRIRGTKSLQQ 302 C++ Q N C G L G + P + S + TF+R G S+ Q Sbjct: 185 CIYVQSINLCMAGRLFGYLCPGMALSQFDLMGSPYRNLTFVRREGEFSVLQ 235 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,239 Number of Sequences: 438 Number of extensions: 3475 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 32290713 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -