BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L17 (975 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0080 + 587674-588510 38 0.012 02_05_0686 - 30900748-30902167,30903442-30904742 36 0.049 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 34 0.20 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 34 0.20 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 33 0.46 06_03_0447 + 20878444-20878821 32 0.80 01_01_0895 + 7052118-7053110,7053249-7053252,7054450-7055189 32 0.80 11_01_0359 - 2731522-2732346 31 1.4 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 31 1.8 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.8 01_01_0083 + 631196-631675 31 1.8 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 30 2.4 03_02_0738 - 10824121-10825572 30 2.4 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 30 2.4 08_01_0059 - 394001-394708 30 3.2 07_03_1136 + 24218601-24218734,24218769-24219906 30 3.2 04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 30 3.2 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 4.2 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 29 4.2 07_01_0862 - 7172083-7172931 29 4.2 04_04_1049 + 30414545-30414596,30414732-30414853,30415121-304151... 29 4.2 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 4.2 11_06_0671 + 26099292-26099491,26099589-26099622,26104787-261048... 29 5.6 11_06_0610 - 25449085-25453284 29 5.6 09_04_0258 - 16175258-16176069,16176111-16176414 29 5.6 07_03_1788 + 29523216-29524867,29525048-29525075 29 5.6 04_04_1104 - 30928475-30928501,30929008-30929110,30929287-309293... 29 5.6 03_01_0515 - 3864796-3865425 29 5.6 01_06_1377 + 36764461-36765339 29 5.6 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 29 7.4 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 29 7.4 07_03_0559 + 19475893-19476783 29 7.4 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 7.4 03_01_0023 + 198414-198968 29 7.4 01_07_0082 - 40965947-40967023 29 7.4 12_02_1174 - 26696869-26698191 28 9.8 11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 28 9.8 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 28 9.8 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 28 9.8 08_02_1410 - 26876243-26876497,26877129-26877239,26877240-268773... 28 9.8 08_02_0796 - 21300251-21300373,21300846-21301721 28 9.8 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 28 9.8 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 28 9.8 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 28 9.8 01_03_0005 + 11568545-11569119,11569179-11569191 28 9.8 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 28 9.8 >07_01_0080 + 587674-588510 Length = 278 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P G G F PPPP G PPP PP P PP Sbjct: 80 PRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P K PPPP G PPP PP K P PP Sbjct: 340 PPKGPPPPPPAKG-----PPPPPPPKGPSPP 365 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P K PPPP G PPP PP K P PP Sbjct: 331 PPKAAPPPPPPKG-----PPPPPPAKGPPPP 356 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPPP PPP PP P PP G Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKG 343 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKN---PXPPXXGG 659 P K PPPP PPP P K P PP GG Sbjct: 348 PPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGG 385 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP PPP PP K PP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPP 338 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P +G P+ PPPP G PPP PP P G Sbjct: 349 PAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAPG 394 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP G F PPP PP P PP Sbjct: 546 PPPPPPPPPSGNKPAFSPPPPPPPP--PPPP 574 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 555 PQKKXPPPPX-GXGXXFLXPPPXPP 626 P + PPPP G G F PPP PP Sbjct: 646 PNRLVPPPPAPGIGNKFPAPPPPPP 670 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP G PPP PP + P PP Sbjct: 751 PPPPLMTGKKAPAPPPPPP-QAPKPP 775 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKN--PXPP 647 P PPPP + PPP P N P PP Sbjct: 634 PPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPP 666 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 33.9 bits (74), Expect = 0.20 Identities = 32/114 (28%), Positives = 35/114 (30%), Gaps = 5/114 (4%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKK--KX 494 P PP GG PP PPP + G P F P P Sbjct: 9 PHPPPPQGGFPPQPPPMNPY----GPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPP 64 Query: 495 XXXIXFXFFX-PXRGXXGXFXPQK--KXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 F F P + PQ + PPPP G PPP PP PP Sbjct: 65 PHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPP 118 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 558 QKKXPPPPXGXGXXFLXPPPXPPXKNPXP 644 Q PPPP PPP PP P P Sbjct: 105 QPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 609 PPPXPPXKNPXPPXXGGG 662 PPP PP ++P PP GGG Sbjct: 9 PPPPPPPQHPPPPQAGGG 26 >06_03_0447 + 20878444-20878821 Length = 125 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P R G P P PP L PPP P PP GGG Sbjct: 38 PSRQIDGGKAPPPPRPIPPDLVEGRALAPPPPPLPLTTLPPDSGGG 83 >01_01_0895 + 7052118-7053110,7053249-7053252,7054450-7055189 Length = 578 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 561 KKXPPPPXGXGXXFLXPPPXPP 626 KK PPPP G G L PP PP Sbjct: 32 KKRPPPPCGDGGRRLPLPPSPP 53 >11_01_0359 - 2731522-2732346 Length = 274 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP PPP PP +P PP Sbjct: 53 PPPPPHAYHHHHYPPPPPPHHHPYPP 78 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPP + PPP PP P PP Sbjct: 9 PPPTPSPPPFSSRPRVVGPPPPPPSDPPPPP 39 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 564 KXPPPPXGXGXXFLXPPP---XPPXKNPXPPXXGG 659 + PPPP G PPP PP P PP GG Sbjct: 294 RIPPPPVGGTQPPPPPPPLANGPPRSIPPPPMTGG 328 >01_01_0083 + 631196-631675 Length = 159 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +3 Query: 519 FXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 + P +G G + P + P G G F P P PP NP P Sbjct: 77 YPPPQGGGGGYIPYYQPPAGGGGGGGGFNYPAPPPP--NPIVP 117 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP PPP PP + PP Sbjct: 1164 PPPATPPPPPPLSPSLPPPPPPPPLPSGPPP 1194 >03_02_0738 - 10824121-10825572 Length = 483 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PP PPP PP +P PP Sbjct: 81 PSPPSSSPPPLSFPPPPPPPSSPPPP 106 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP PPP PP K PP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 >08_01_0059 - 394001-394708 Length = 235 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 555 PQKKXPPPPXGXGXX--FLXPPPXPPXKNPXPP 647 P ++ PPPP PPP PP + P PP Sbjct: 6 PPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 38 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 661 PPPXXGGXGFXXGGXGGGXKXXXPFPXGGGG 569 P P GG GG GGG P GGGG Sbjct: 98 PGPLGGGGARPPGGGGGGGPPSLPPGAGGGG 128 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -3 Query: 658 PPXXGGXGFXXG---GXGGGXKXXXPFPXGGGG 569 PP GG G G GGG P P GGGG Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGG 140 >04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 Length = 676 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 P RG + P PPPP G ++ PPP P + PP G Sbjct: 491 PPRGNPPSWVP---LPPPPGGNAPSWVPPPPQP--RGIAPPEYG 529 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPPP G PPP P P PP G Sbjct: 615 PPPPRPPGAPPPPPPPGKPGGPPPPPPRPG 644 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P PPPP G PPP PP P GG Sbjct: 621 PGAPPPPPPPGKPG---GPPPPPPRPGSLPRNLAGG 653 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPPP G PPP P P PP G Sbjct: 920 PPPPRPPGAPPPPPPPGKPGGPPPPPPPPG 949 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P PPPP G PPP PP P GG Sbjct: 926 PGAPPPPPPPGKPGG---PPPPPPPPGSLPRNLAGG 958 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 555 PQKKX---PPPPXGXGXXFLXPPPXPPXKNPXPP 647 P+KK P P L PPP PP K P PP Sbjct: 152 PRKKAMLFPLPLPPRKKPLLYPPPLPPKKKPLPP 185 >04_04_1049 + 30414545-30414596,30414732-30414853,30415121-30415198, 30415329-30415459,30415644-30417552,30417797-30417836, 30418194-30418259,30418583-30418734 Length = 849 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXP----PXKNPXPPXXGG 659 PPPP G ++ PPP P P P PP G Sbjct: 483 PPPPRGNAPSWVPPPPQPRGNAPSCVPPPPQSRG 516 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 549 FXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 F Q PPPP PP PP N PP Sbjct: 978 FTRQDIPPPPPSPPPLPITQPPSVPPPPNSPPP 1010 >11_06_0671 + 26099292-26099491,26099589-26099622,26104787-26104813, 26105557-26105642,26105735-26105783,26105969-26106018, 26106692-26107185,26107379-26107539,26107808-26108017, 26108100-26108292,26108367-26108444,26108555-26108649, 26109158-26109280 Length = 599 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPP 617 P++K PPPP G + PPP Sbjct: 3 PKRKSPPPPPPHGPVVVVPPP 23 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 29.1 bits (62), Expect = 5.6 Identities = 21/76 (27%), Positives = 24/76 (31%), Gaps = 2/76 (2%) Frame = +3 Query: 435 GKXGXPXXFWXPXXPXKKKXXXXIXFX--FFXPXRGXXGXFXPQKKXPPPPXGXGXXFLX 608 G P W P P +KK + P P+ K PP P Sbjct: 509 GAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHS---- 564 Query: 609 PPPXPPXKNPXPPXXG 656 PPP P P PP G Sbjct: 565 PPPVPEGHTPSPPKSG 580 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P +K PPPP L P PP + PP Sbjct: 869 PPEKSPPPPETKSPPTLTPEISPPPEGKSPP 899 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P +K PPPP + PPP P K+P PP Sbjct: 1147 PPEKSPPPPA----PVILPPP--PIKSPPPP 1171 >09_04_0258 - 16175258-16176069,16176111-16176414 Length = 371 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 403 GGGAXPPXXFFXXGGPXXPPPRGG 332 GGGA PP G PPP GG Sbjct: 218 GGGASPPPLPVRVGASTPPPPHGG 241 >07_03_1788 + 29523216-29524867,29525048-29525075 Length = 559 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PP G G PPP PP NP PP G Sbjct: 18 PPKRGRGRPRKNPPPPPPPATDPNPHPPSGAG 49 >04_04_1104 - 30928475-30928501,30929008-30929110,30929287-30929340, 30929803-30929895,30930063-30930140,30930416-30930527, 30930618-30930756,30930823-30930910,30930984-30931079, 30931675-30931781,30931874-30932009,30932089-30932186, 30932954-30933047,30933132-30933301,30933749-30933819, 30936066-30936194,30936552-30936654,30936764-30936907, 30937123-30937245,30937482-30937563,30939044-30939120, 30939261-30939315,30939365-30939443,30939544-30939620, 30939739-30939869,30939947-30940120,30940245-30940310, 30940937-30941572 Length = 1113 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 516 FFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 F P G PQ PPP P P P P P GG Sbjct: 34 FICPKCGMAQRLPPQLMPKPPPSSSSSAAATPAPPAPAAPPPPTSRRGG 82 >03_01_0515 - 3864796-3865425 Length = 209 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP L PPP PP +P PP Sbjct: 83 PPPPP------LPPPPPPPAASPPPP 102 >01_06_1377 + 36764461-36765339 Length = 292 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 P+ + PPP + PPP P P PP G Sbjct: 158 PEPQYPPP--SSSPYYFPPPPPPAYSAPPPPQYG 189 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 PPPP + PPP PP + P GGG Sbjct: 67 PPPPPAAFFAAVPPPPPPPFEY-YPAVGGGG 96 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 658 PPXXGGXGFXXGGXGGGXKXXXPFPXGGGG 569 PP G GG GGG P GGGG Sbjct: 84 PPFPSGNTRGGGGGGGGSSMQQQQPGGGGG 113 >07_03_0559 + 19475893-19476783 Length = 296 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 646 GGXGFXXGGXGGGXKXXXPFPXGGGGXFFXG 554 GG G GG GGG F GGGG G Sbjct: 68 GGGGGFRGGGGGGLGGGGGFGGGGGGGLGGG 98 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 400 GGAXPPXXFFXXGGPXXPPPRGGXXPG 320 GG PP GGP PPP G G Sbjct: 1146 GGVPPPPPVGGLGGPPAPPPPAGFRGG 1172 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPX--KNPXPPXXGGG 662 PPPP G + PP PP P PP GG Sbjct: 1184 PPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGG 1216 >03_01_0023 + 198414-198968 Length = 184 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 661 PPPXXGGXGFXXGGXGGGXKXXXPFPXGGGG 569 P P GG G GG GGG + GG G Sbjct: 33 PSPGGGGGGGGGGGGGGGGRGGGGGSGGGSG 63 >01_07_0082 - 40965947-40967023 Length = 358 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P PPP G G PPP P PP G Sbjct: 251 PYGTAPPPQYGYGYPAQPPPPQAGYGYPPPPPQAG 285 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXF---LXPPPXPPXKNPXPP 647 P+ + PPPP L P P PP +P PP Sbjct: 242 PKPQPPPPPPRAPVKMPRVLEPKPSPPPPSPLPP 275 >11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 Length = 515 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 661 PPPXXGGXGFXXGGXGGGXKXXXPFPXGGG 572 PPP GG G GG GG GGG Sbjct: 244 PPPNAGGGGDKKGGNNGGGAGNGGKKGGGG 273 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP P P PP P PP Sbjct: 328 PPAPPPPPPPPSRFNNTTPKPPPPPPPPEPP 358 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP PPP P P PP Sbjct: 220 PPPPPPPPPSPHRHPAAHPPPPPHHPAPRPP 250 >08_02_1410 - 26876243-26876497,26877129-26877239,26877240-26877324, 26877620-26877672,26878318-26878440,26878514-26878597, 26878708-26878773,26879512-26879584,26879854-26879888, 26879970-26880212 Length = 375 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 625 GGXGGGXKXXXPFPXGGGG 569 GG GGG + P P GGGG Sbjct: 17 GGGGGGGEGLNPNPSGGGG 35 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 561 KKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 ++ P P L PPP PP P PP Sbjct: 88 RRLPEAPPSPPLLALPPPPPPPPPPPPPP 116 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 PPP G G PPP PP P GGG Sbjct: 5 PPPPGTGA----PPPPPPAAVGPPGGVGGG 30 >05_07_0236 - 28582157-28582552,28582639-28582911,28583324-28583560, 28583653-28583694,28583782-28583964,28584393-28584524, 28585605-28586057 Length = 571 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +3 Query: 531 RGXXGXFXPQKKXPPPPXGXGXXF-LXPPPXPPXKNPXPP 647 R G P PPP G G PPP PP P P Sbjct: 85 RPVQGKGHPAPTMPPPSSGSGHTLPSPPPPLPPLLPPPQP 124 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 646 GGXGFXXGGXGGGXKXXXPFPXGGGG 569 GG G+ GG GGG + GGGG Sbjct: 72 GGRGYGGGGGGGGYESGGGRGYGGGG 97 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 661 PPPXXGGXGFXXGGXGGGXKXXXPFPXGGGG 569 PPP G G GGG P GGGG Sbjct: 93 PPPPYSGGGGGSSTGGGGIYYPPPTGGGGGG 123 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 646 GGXGFXXGGXGGGXKXXXPFPXGGGGXFFXG 554 GG G+ GG GGG GGGG + G Sbjct: 58 GGGGYGGGGVGGGYGGGGGGYGGGGGGYGGG 88 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 661 PPPXXGGXGFXXGGXGGGXKXXXPFPXGGGG 569 PP GG G GGG P+ GGGG Sbjct: 375 PPSYDGGYGGRPMPGGGGPGAPPPYHGGGGG 405 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 661 PPPXXGGXGFXXGGXGGG 608 PPP GG G GG GGG Sbjct: 396 PPPYHGGGGGGGGGGGGG 413 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,219,013 Number of Sequences: 37544 Number of extensions: 347408 Number of successful extensions: 3240 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2645 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2834967080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -