BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L17 (975 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 37 0.097 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 37 0.097 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 37 0.097 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 37 0.097 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 37 0.097 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 37 0.13 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 37 0.13 D29833-1|BAA06213.1| 79|Homo sapiens proline rich peptide P-B ... 35 0.39 BC015327-1|AAH15327.1| 79|Homo sapiens submaxillary gland andr... 35 0.39 AB031740-1|BAA88517.1| 79|Homo sapiens salivary proline-rich p... 35 0.39 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 34 0.90 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 34 0.90 BC094707-1|AAH94707.1| 106|Homo sapiens SMR3B protein protein. 34 0.90 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 34 0.90 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 34 0.90 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 34 0.90 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 33 1.2 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 33 1.2 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 33 1.2 Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. 33 1.6 D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. 33 1.6 D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternativel... 33 1.6 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 33 1.6 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 33 1.6 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 33 1.6 BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. 33 1.6 BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. 33 1.6 BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. 33 1.6 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 33 1.6 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 33 1.6 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 33 1.6 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 33 1.6 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 33 1.6 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 33 1.6 BC128191-1|AAI28192.1| 183|Homo sapiens PRB4 protein protein. 32 2.8 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 32 2.8 AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens ... 32 2.8 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 32 2.8 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 32 2.8 X07881-1|CAA30728.1| 309|Homo sapiens proline-rich protein G1 p... 32 3.6 X07517-1|CAA30395.2| 236|Homo sapiens salivary proline-rich pro... 32 3.6 K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary ... 32 3.6 DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. 32 3.6 BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (D... 32 3.6 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 32 3.6 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 32 3.6 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 32 3.6 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 32 3.6 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 32 3.6 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 32 3.6 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 32 3.6 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 31 4.8 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 31 4.8 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 31 4.8 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 31 4.8 M13058-1|AAA98808.1| 166|Homo sapiens proline-rich protein 2 pr... 31 4.8 M13057-1|AAA98807.1| 166|Homo sapiens proline-rich protein 1 pr... 31 4.8 K03203-1|AAA60184.1| 166|Homo sapiens PRH1 protein. 31 4.8 K03202-1|AAA60183.1| 166|Homo sapiens PRH2 protein. 31 4.8 BX641094-1|CAE46044.1| 166|Homo sapiens hypothetical protein pr... 31 4.8 BC141916-1|AAI41917.1| 170|Homo sapiens PRH2 protein protein. 31 4.8 BC133676-1|AAI33677.1| 166|Homo sapiens proline-rich protein Ha... 31 4.8 BC128192-1|AAI28193.1| 171|Homo sapiens PRH1 protein protein. 31 4.8 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 31 4.8 BC095488-1|AAH95488.1| 166|Homo sapiens PRH2 protein protein. 31 4.8 BC064553-1|AAH64553.1| 187|Homo sapiens PRH1 protein protein. 31 4.8 AY188338-1|AAO12060.1| 903|Homo sapiens ataxin-2-like protein p... 31 4.8 AY188337-1|AAO12059.1| 903|Homo sapiens ataxin-2-like protein p... 31 4.8 AY188336-1|AAO12058.1| 903|Homo sapiens ataxin-2-like protein p... 31 4.8 AY188335-1|AAO12057.1| 883|Homo sapiens ataxin-2-like protein p... 31 4.8 AY188334-1|AAO12056.1| 883|Homo sapiens ataxin-2-like protein p... 31 4.8 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 31 4.8 AF034373-1|AAC69607.1| 1051|Homo sapiens ataxin-2-like protein A... 31 4.8 X07882-1|CAA30729.1| 226|Homo sapiens Po protein protein. 31 6.4 X07704-1|CAA30542.1| 234|Homo sapiens Po protein protein. 31 6.4 U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated pr... 31 6.4 S80916-1|AAB50687.2| 238|Homo sapiens parotid 'o' protein protein. 31 6.4 K03207-1|AAA60188.1| 247|Homo sapiens salivary proline-rich pro... 31 6.4 BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein pr... 31 6.4 BC130386-1|AAI30387.1| 268|Homo sapiens PRB4 protein protein. 31 6.4 BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. 31 6.4 BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. 31 6.4 AK129677-1|BAC85214.1| 168|Homo sapiens protein ( Homo sapiens ... 31 6.4 X07516-1|CAA30394.2| 297|Homo sapiens salivary proline-rich pro... 31 8.4 S80905-1|AAB50686.1| 382|Homo sapiens Con1 protein. 31 8.4 S62941-1|AAB27289.1| 358|Homo sapiens Ps 2 protein. 31 8.4 S62928-1|AAB27288.2| 297|Homo sapiens PRB1M protein precursor p... 31 8.4 S52986-1|AAA13341.2| 331|Homo sapiens basic salivary proline-ri... 31 8.4 M97220-1|AAB05816.1| 331|Homo sapiens salivary proline-rich pro... 31 8.4 K03208-1|AAA60189.1| 251|Homo sapiens PRB2 protein. 31 8.4 K03204-1|AAA60185.1| 331|Homo sapiens PRB1 protein. 31 8.4 D89501-1|BAA13971.1| 134|Homo sapiens PBI protein. 31 8.4 BC096212-1|AAH96212.1| 162|Homo sapiens PRB3 protein protein. 31 8.4 BC096211-1|AAH96211.1| 309|Homo sapiens PRB3 protein protein. 31 8.4 BC096210-1|AAH96210.1| 309|Homo sapiens PRB3 protein protein. 31 8.4 BC096209-1|AAH96209.1| 309|Homo sapiens PRB3 protein protein. 31 8.4 BC044827-1|AAH44827.1| 338|Homo sapiens PRB2 protein protein. 31 8.4 BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subuni... 31 8.4 BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IM... 31 8.4 AL646016-1|CAI17009.1| 1865|Homo sapiens formin 2 protein. 31 8.4 AL590490-1|CAH70931.1| 1865|Homo sapiens formin 2 protein. 31 8.4 AL513342-1|CAI17121.1| 1865|Homo sapiens formin 2 protein. 31 8.4 AL359918-1|CAI15795.1| 1865|Homo sapiens formin 2 protein. 31 8.4 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 31 8.4 AJ277365-1|CAC10539.1| 796|Homo sapiens polyglutamine-containin... 31 8.4 AB058768-1|BAB47494.1| 723|Homo sapiens KIAA1865 protein protein. 31 8.4 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 37.1 bits (82), Expect = 0.097 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 PPPP G G + PPP PP P PP G G Sbjct: 382 PPPPPGAGGPPMPPPPPPP---PPPPSSGNG 409 Score = 29.9 bits (64), Expect(2) = 0.16 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P G G P PPPP PPP PP P GG Sbjct: 384 PPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGG 429 Score = 25.4 bits (53), Expect(2) = 0.16 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 324 GXXPPLGGGXXGPPXKKKXXGGXAPPP 404 G PP GG PP G PPP Sbjct: 358 GPPPPGRGGPPPPPPPATGRSGPLPPP 384 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 37.1 bits (82), Expect = 0.097 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 PPPP G G + PPP PP P PP G G Sbjct: 382 PPPPPGAGGPPMPPPPPPP---PPPPSSGNG 409 Score = 29.9 bits (64), Expect(2) = 0.16 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P G G P PPPP PPP PP P GG Sbjct: 384 PPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGG 429 Score = 25.4 bits (53), Expect(2) = 0.16 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 324 GXXPPLGGGXXGPPXKKKXXGGXAPPP 404 G PP GG PP G PPP Sbjct: 358 GPPPPGRGGPPPPPPPATGRSGPLPPP 384 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 37.1 bits (82), Expect = 0.097 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 PPPP G G + PPP PP P PP G G Sbjct: 382 PPPPPGAGGPPMPPPPPPP---PPPPSSGNG 409 Score = 29.9 bits (64), Expect(2) = 0.16 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P G G P PPPP PPP PP P GG Sbjct: 384 PPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGG 429 Score = 25.4 bits (53), Expect(2) = 0.16 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 324 GXXPPLGGGXXGPPXKKKXXGGXAPPP 404 G PP GG PP G PPP Sbjct: 358 GPPPPGRGGPPPPPPPATGRSGPLPPP 384 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 37.1 bits (82), Expect = 0.097 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 PPPP G G + PPP PP P PP G G Sbjct: 394 PPPPPGAGGPPMPPPPPPP---PPPPSSGNG 421 Score = 29.9 bits (64), Expect(2) = 0.16 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 525 PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P G G P PPPP PPP PP P GG Sbjct: 396 PPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGG 441 Score = 25.4 bits (53), Expect(2) = 0.16 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 324 GXXPPLGGGXXGPPXKKKXXGGXAPPP 404 G PP GG PP G PPP Sbjct: 370 GPPPPGRGGPPPPPPPATGRSGPLPPP 396 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 37.1 bits (82), Expect = 0.097 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 PPPP G G + PPP PP P PP G G Sbjct: 382 PPPPPGAGGPPMPPPPPPP---PPPPSSGNG 409 Score = 31.1 bits (67), Expect = 6.4 Identities = 31/111 (27%), Positives = 34/111 (30%), Gaps = 1/111 (0%) Frame = +3 Query: 333 PPLGGGXXGPPXKKKXXG-GXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKKKXXXXIX 509 PP+ GG G G APPP G+ G P P P + Sbjct: 329 PPIAGGNKGRSGPLPPVPLGIAPPPPTPRGPPP-PGRGGPP-----PPPPPATGRSGPLP 382 Query: 510 FXFFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGG 662 P G G P PPPP PPP PP P GG Sbjct: 383 ----PPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGG 429 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 36.7 bits (81), Expect = 0.13 Identities = 33/116 (28%), Positives = 34/116 (29%), Gaps = 3/116 (2%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLG--KXGXPXXFWXPXXPXKKKX 494 P PPLG PP K G APPP +G P F P P Sbjct: 428 PPPAPPLGS----PPSSKP---GFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSS 480 Query: 495 XXXIXFX-FFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 F P PPPP PPP PP P PP G Sbjct: 481 PSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTG 536 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 36.7 bits (81), Expect = 0.13 Identities = 33/116 (28%), Positives = 34/116 (29%), Gaps = 3/116 (2%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLG--KXGXPXXFWXPXXPXKKKX 494 P PPLG PP K G APPP +G P F P P Sbjct: 299 PPPAPPLGS----PPSSKP---GFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSS 351 Query: 495 XXXIXFX-FFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 F P PPPP PPP PP P PP G Sbjct: 352 PSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTG 407 >D29833-1|BAA06213.1| 79|Homo sapiens proline rich peptide P-B protein. Length = 79 Score = 35.1 bits (77), Expect = 0.39 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +3 Query: 531 RGXXGXFXPQKKXPPPPXGXGXXFLXPPPXP---PXKNPXPP 647 RG G + P PP P G G F+ PPP P P + P PP Sbjct: 24 RGPRGPYPPGPLAPPQPFGPG--FVPPPPPPPYGPGRIPPPP 63 >BC015327-1|AAH15327.1| 79|Homo sapiens submaxillary gland androgen regulated protein 3 homolog B (mouse) protein. Length = 79 Score = 35.1 bits (77), Expect = 0.39 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +3 Query: 531 RGXXGXFXPQKKXPPPPXGXGXXFLXPPPXP---PXKNPXPP 647 RG G + P PP P G G F+ PPP P P + P PP Sbjct: 24 RGPRGPYPPGPLAPPQPFGPG--FVPPPPPPPYGPGRIPPPP 63 >AB031740-1|BAA88517.1| 79|Homo sapiens salivary proline-rich protein P-B protein. Length = 79 Score = 35.1 bits (77), Expect = 0.39 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +3 Query: 531 RGXXGXFXPQKKXPPPPXGXGXXFLXPPPXP---PXKNPXPP 647 RG G + P PP P G G F+ PPP P P + P PP Sbjct: 24 RGPRGPYPPGPLAPPQPFGPG--FVPPPPPPPYGPGRIPPPP 63 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNP 638 P PPPP G + PPP PP +P Sbjct: 582 PPPPPPPPPGSAGMMYAPPPPPPPPMDP 609 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNP 638 P PPPP G + PPP PP +P Sbjct: 582 PPPPPPPPPVSAGMMYAPPPPPPPPMDP 609 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >BC094707-1|AAH94707.1| 106|Homo sapiens SMR3B protein protein. Length = 106 Score = 33.9 bits (74), Expect = 0.90 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 531 RGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPP 626 RG G + P PP P G G F+ PPP PP Sbjct: 24 RGPRGPYPPGPLAPPQPFGPG--FVPPPPPPP 53 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 33.9 bits (74), Expect = 0.90 Identities = 29/121 (23%), Positives = 35/121 (28%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKKKXXX 500 P PP G PP + + G PPP + P P P + Sbjct: 289 PPPPPPHNSGPPPPPARGR--GAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNR----- 341 Query: 501 XIXFXFFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGGXXXXXT 680 + P P PPPP G + PPP PP P P G Sbjct: 342 -----MYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGD 396 Query: 681 H 683 H Sbjct: 397 H 397 Score = 30.7 bits (66), Expect = 8.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKN---PXPPXXGGG 662 PPPP G PPP PP N P PP G G Sbjct: 278 PPPPPSRGG---PPPPPPPPHNSGPPPPPARGRG 308 >BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger protein 162 protein. Length = 265 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNP 638 P PPPP G + PPP PP +P Sbjct: 208 PPPPPPPPPGSAGMMYAPPPPPPPPMDP 235 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 97 PPPPMG----MMPPPPPPPSGQPPPPPSG 121 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 33.9 bits (74), Expect = 0.90 Identities = 29/121 (23%), Positives = 35/121 (28%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKKKXXX 500 P PP G PP + + G PPP + P P P + Sbjct: 289 PPPPPPHNSGPPPPPARGR--GAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNR----- 341 Query: 501 XIXFXFFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGGXXXXXT 680 + P P PPPP G + PPP PP P P G Sbjct: 342 -----MYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGD 396 Query: 681 H 683 H Sbjct: 397 H 397 Score = 30.7 bits (66), Expect = 8.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKN---PXPPXXGGG 662 PPPP G PPP PP N P PP G G Sbjct: 278 PPPPPSRGG---PPPPPPPPHNSGPPPPPARGRG 308 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 33.5 bits (73), Expect = 1.2 Identities = 29/121 (23%), Positives = 35/121 (28%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKKKXXX 500 P PP G PP + + G PPP + P P P + Sbjct: 289 PPPPPPHSSGPPPPPARGR--GAPPPPPSRAPTAAPPPPPPSRPSVEVPPPPPNR----- 341 Query: 501 XIXFXFFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGGXXXXXT 680 + P P PPPP G + PPP PP P P G Sbjct: 342 -----MYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGD 396 Query: 681 H 683 H Sbjct: 397 H 397 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P+ PPPP + PPP PP P PP Sbjct: 311 PEDPLPPPPSEKKPEKVTPPPPPPPPPPPPP 341 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P+ PPPP + PPP PP P PP Sbjct: 311 PEDPLPPPPSEKKPEKVTPPPPPPPPPPPPP 341 >Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. Length = 638 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. Length = 623 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternatively spliced product protein. Length = 548 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 543 GXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 G P PPPP G PPP PP PP Sbjct: 164 GDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 198 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXP 644 PPPP G G PPP PP P P Sbjct: 335 PPPPVGFGSPGTPPPPSPPSFPPHP 359 Score = 32.7 bits (71), Expect = 2.1 Identities = 33/117 (28%), Positives = 34/117 (29%), Gaps = 4/117 (3%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLG--KXGXPXXFWXPXXPXKKKX 494 P PPLG PP K G APPP +G P F P P Sbjct: 300 PPPAPPLGS----PPGPKP---GFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSP 352 Query: 495 XXXIXFX-FFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPX-PPXKNPXPPXXGG 659 F P PPPP PPP PP P PP G Sbjct: 353 PSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTG 409 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 596 PPPPMG----MMPPPPPPPSGQPPPPPSG 620 Score = 32.3 bits (70), Expect = 2.8 Identities = 31/119 (26%), Positives = 34/119 (28%), Gaps = 5/119 (4%) Frame = +3 Query: 321 PGXXP---PLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKKK 491 PG P P GG GPP G P +G F P Sbjct: 16 PGLPPLPGPKGGFEPGPPPAPGPGAGLLAPGPPPPPPVGSMGALTAAFPFAALPPPPPPP 75 Query: 492 XXXXIXFXFFXPXRGXXGXFXPQKKXPPPPXGXGXXF--LXPPPXPPXKNPXPPXXGGG 662 P G P + PPPP PPP PP K+ P GGG Sbjct: 76 PPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPPRKDQQPGPAGGG 134 Score = 30.7 bits (66), Expect = 8.4 Identities = 31/106 (29%), Positives = 33/106 (31%), Gaps = 2/106 (1%) Frame = +3 Query: 336 PLGG-GXXGPPXKKKXXGGXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKKKXXXXIXF 512 PLG G G P GG P P L G P P P F Sbjct: 9 PLGKLGPPGLPPLPGPKGGFEPGPPPAPGPGAGLLAPGPP-----PPPPVGSMGALTAAF 63 Query: 513 XFFX-PXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 F P P ++ PPPP PPP PP P PP Sbjct: 64 PFAALPPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPP---PPPP 106 >BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXG 656 PPPP G + PPP PP P PP G Sbjct: 471 PPPPMG----MMPPPPPPPSGQPPPPPSG 495 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 543 GXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 G P PPPP G PPP PP PP Sbjct: 582 GDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 33.1 bits (72), Expect = 1.6 Identities = 29/121 (23%), Positives = 35/121 (28%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLGKXGXPXXFWXPXXPXKKKXXX 500 P PP G PP + + G PPP + P P P + Sbjct: 289 PPPPPPHNSGPPPPPARGR--GAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNR----- 341 Query: 501 XIXFXFFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGGGXXXXXT 680 + P P PPPP G + PPP PP P P G Sbjct: 342 -----MYPPPPPALLSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGD 396 Query: 681 H 683 H Sbjct: 397 H 397 Score = 30.7 bits (66), Expect = 8.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKN---PXPPXXGGG 662 PPPP G PPP PP N P PP G G Sbjct: 278 PPPPPSRGG---PPPPPPPPHNSGPPPPPARGRG 308 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXP 644 PPPP G G PPP PP P P Sbjct: 335 PPPPVGFGSPGTPPPPSPPSFPPHP 359 Score = 32.7 bits (71), Expect = 2.1 Identities = 33/117 (28%), Positives = 34/117 (29%), Gaps = 4/117 (3%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLG--KXGXPXXFWXPXXPXKKKX 494 P PPLG PP K G APPP +G P F P P Sbjct: 300 PPPAPPLGS----PPGPKP---GFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSP 352 Query: 495 XXXIXFX-FFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPX-PPXKNPXPPXXGG 659 F P PPPP PPP PP P PP G Sbjct: 353 PSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTG 409 >AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens cDNA FLJ90750 fis, clone PLACE2000118, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG. ). Length = 169 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXP 644 PPPP G G PPP PP P P Sbjct: 7 PPPPVGFGSPGTPPPPSPPSFPPHP 31 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPPP PPP PP P PP G Sbjct: 51 PPPPLSQPTGGAPPPPPPPPPGPPPPPFTG 80 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 543 GXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 G P PPPP G PPP PP PP Sbjct: 473 GDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 507 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXP 644 PPPP G G PPP PP P P Sbjct: 335 PPPPVGFGSPGTPPPPSPPSFPPHP 359 Score = 32.7 bits (71), Expect = 2.1 Identities = 33/117 (28%), Positives = 34/117 (29%), Gaps = 4/117 (3%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXGGXAPPPXKXXXKXXFLG--KXGXPXXFWXPXXPXKKKX 494 P PPLG PP K G APPP +G P F P P Sbjct: 300 PPPAPPLGS----PPGPKP---GFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSP 352 Query: 495 XXXIXFX-FFXPXRGXXGXFXPQKKXPPPPXGXGXXFLXPPPX-PPXKNPXPPXXGG 659 F P PPPP PPP PP P PP G Sbjct: 353 PSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTG 409 >BC128191-1|AAI28192.1| 183|Homo sapiens PRB4 protein protein. Length = 183 Score = 32.3 bits (70), Expect = 2.8 Identities = 32/119 (26%), Positives = 37/119 (31%), Gaps = 6/119 (5%) Frame = +3 Query: 321 PGXXPPLGGGXXGPPXKKKXXG-GXAPPPXKXXXKXXFLGKX--GXPXXFWXPXXPXKKK 491 P PP G GPP + G PPP K + G G P P P + Sbjct: 47 PQRPPPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQG 106 Query: 492 XXXXIXFXFFXPXRGXX---GXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + G P K PPP G PP + P PP GG Sbjct: 107 GNQSQGKPQGPPQQEGNKPQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPPPPQGG 165 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPP G PPP PP P PP GG Sbjct: 597 PPPPAPGDSTTPPPPPPPPP-PPPPLPGG 624 >AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens cDNA FLJ13283 fis, clone OVARC1001113, highly similar to Homo sapiens diaphanous 1 (HDIA1) mRNA. ). Length = 533 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPP G PPP PP P PP GG Sbjct: 364 PPPPAPGDSTTPPPPPPPPP-PPPPLPGG 391 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPP G PPP PP P PP GG Sbjct: 588 PPPPAPGDSTTPPPPPPPPP-PPPPLPGG 615 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPP G PPP PP P PP GG Sbjct: 624 PPPPAPGDSTTPPPPPPPPP-PPPPLPGG 651 >X07881-1|CAA30728.1| 309|Homo sapiens proline-rich protein G1 protein. Length = 309 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P++ PPP G PPP + P PP GG Sbjct: 263 PRRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 >X07517-1|CAA30395.2| 236|Homo sapiens salivary proline-rich protein protein. Length = 236 Score = 31.9 bits (69), Expect = 3.6 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P+K PPP G G PPP PP K PP GG Sbjct: 121 PRKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 153 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 60 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 92 >K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary proline-rich protein 1 gene, segment 1. ). Length = 173 Score = 31.9 bits (69), Expect = 3.6 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P+K PPP G G PPP PP K PP GG Sbjct: 138 PRKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 170 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 78 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 110 >DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. Length = 1262 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPP G PPP PP P PP GG Sbjct: 588 PPPPAPGDSTTPPPPPPPP--PPPPLPGG 614 >BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (Drosophila) protein. Length = 1262 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 PPP G PPP PP P PP GG Sbjct: 588 PPPPAPGDSTTPPPPPPPP--PPPPLPGG 614 >BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP G PPP PP P PP Sbjct: 553 PPPPLPGGMLPPPPPPLPPGGPPPPP 578 >BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP G PPP PP P PP Sbjct: 553 PPPPLPGGMLPPPPPPLPPGGPPPPP 578 >BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled associated activator of morphogenesis 2 protein. Length = 662 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP G PPP PP P PP Sbjct: 147 PPPPLPGGMLPPPPPPLPPGGPPPPP 172 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP F PPP P P PP Sbjct: 912 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPP 942 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP F PPP P P PP Sbjct: 912 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPP 942 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPP 647 P PPPP F PPP P P PP Sbjct: 898 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPP 928 >AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. Length = 1085 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPPXKNPXPP 647 PPPP G PPP PP P PP Sbjct: 560 PPPPLPGGMLPPPPPPLPPGGPPPPP 585 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >M13058-1|AAA98808.1| 166|Homo sapiens proline-rich protein 2 protein. Length = 166 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >M13057-1|AAA98807.1| 166|Homo sapiens proline-rich protein 1 protein. Length = 166 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >K03203-1|AAA60184.1| 166|Homo sapiens PRH1 protein. Length = 166 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >K03202-1|AAA60183.1| 166|Homo sapiens PRH2 protein. Length = 166 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >BX641094-1|CAE46044.1| 166|Homo sapiens hypothetical protein protein. Length = 166 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >BC141916-1|AAI41917.1| 170|Homo sapiens PRH2 protein protein. Length = 170 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >BC133676-1|AAI33677.1| 166|Homo sapiens proline-rich protein HaeIII subfamily 1 protein. Length = 166 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >BC128192-1|AAI28193.1| 171|Homo sapiens PRH1 protein protein. Length = 171 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 586 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 618 >BC095488-1|AAH95488.1| 166|Homo sapiens PRH2 protein protein. Length = 166 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 120 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 154 >BC064553-1|AAH64553.1| 187|Homo sapiens PRH1 protein protein. Length = 187 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + P P G PPP PP K PP GG Sbjct: 141 PPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGG 175 >AY188338-1|AAO12060.1| 903|Homo sapiens ataxin-2-like protein protein. Length = 903 Score = 31.5 bits (68), Expect = 4.8 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 549 FXPQKKXPP-PPXGXGXX--FLXPPPXPPXKNPXPPXXGGG 662 F P + PP PP G FL PPP P +P PP G G Sbjct: 12 FPPAARPPPLPPRGASSRRGFLSPPPTP-RGSPRPPTAGPG 51 >AY188337-1|AAO12059.1| 903|Homo sapiens ataxin-2-like protein protein. Length = 903 Score = 31.5 bits (68), Expect = 4.8 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 549 FXPQKKXPP-PPXGXGXX--FLXPPPXPPXKNPXPPXXGGG 662 F P + PP PP G FL PPP P +P PP G G Sbjct: 12 FPPAARPPPLPPRGASSRRGFLSPPPTP-RGSPRPPTAGPG 51 >AY188336-1|AAO12058.1| 903|Homo sapiens ataxin-2-like protein protein. Length = 903 Score = 31.5 bits (68), Expect = 4.8 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 549 FXPQKKXPP-PPXGXGXX--FLXPPPXPPXKNPXPPXXGGG 662 F P + PP PP G FL PPP P +P PP G G Sbjct: 12 FPPAARPPPLPPRGASSRRGFLSPPPTP-RGSPRPPTAGPG 51 >AY188335-1|AAO12057.1| 883|Homo sapiens ataxin-2-like protein protein. Length = 883 Score = 31.5 bits (68), Expect = 4.8 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 549 FXPQKKXPP-PPXGXGXX--FLXPPPXPPXKNPXPPXXGGG 662 F P + PP PP G FL PPP P +P PP G G Sbjct: 12 FPPAARPPPLPPRGASSRRGFLSPPPTP-RGSPRPPTAGPG 51 >AY188334-1|AAO12056.1| 883|Homo sapiens ataxin-2-like protein protein. Length = 883 Score = 31.5 bits (68), Expect = 4.8 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 549 FXPQKKXPP-PPXGXGXX--FLXPPPXPPXKNPXPPXXGGG 662 F P + PP PP G FL PPP P +P PP G G Sbjct: 12 FPPAARPPPLPPRGASSRRGFLSPPPTP-RGSPRPPTAGPG 51 >AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 31.5 bits (68), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 570 PPPPXGXGXXFLXPPPXPP---XKNPXPPXXGG 659 PPPP G + PPP PP P PP GG Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 >AF034373-1|AAC69607.1| 1051|Homo sapiens ataxin-2-like protein A2LP protein. Length = 1051 Score = 31.5 bits (68), Expect = 4.8 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 549 FXPQKKXPP-PPXGXGXX--FLXPPPXPPXKNPXPPXXGGG 662 F P + PP PP G FL PPP P +P PP G G Sbjct: 12 FPPAARPPPLPPRGASSRRGFLSPPPTP-RGSPRPPTAGPG 51 >X07882-1|CAA30729.1| 226|Homo sapiens Po protein protein. Length = 226 Score = 31.1 bits (67), Expect = 6.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 96 PGKPERPPPQG-GNQSHRPPP-PPGKPERPPPQGG 128 >X07704-1|CAA30542.1| 234|Homo sapiens Po protein protein. Length = 234 Score = 31.1 bits (67), Expect = 6.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 104 PGKPERPPPQG-GNQSHRPPP-PPGKPERPPPQGG 136 >U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated protein protein. Length = 872 Score = 31.1 bits (67), Expect = 6.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P PPPP G G F P PP P PP G Sbjct: 81 PPPPPPPPPPGLGLGF--PMAHPPNLGPPPPLRVG 113 >S80916-1|AAB50687.2| 238|Homo sapiens parotid 'o' protein protein. Length = 238 Score = 31.1 bits (67), Expect = 6.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 108 PGKPERPPPQG-GNQSHRPPP-PPGKPERPPPQGG 140 >K03207-1|AAA60188.1| 247|Homo sapiens salivary proline-rich protein precursor protein. Length = 247 Score = 31.1 bits (67), Expect = 6.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 117 PGKPERPPPQG-GNQSHRPPP-PPGKPERPPPQGG 149 >BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein protein. Length = 799 Score = 31.1 bits (67), Expect = 6.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P PPPP G G F P PP P PP G Sbjct: 106 PPPPPPPPPPGLGLGF--PMAHPPNLGPPPPLRVG 138 >BC130386-1|AAI30387.1| 268|Homo sapiens PRB4 protein protein. Length = 268 Score = 31.1 bits (67), Expect = 6.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 138 PGKPERPPPQG-GNQSHRPPP-PPGKPERPPPQGG 170 >BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. Length = 877 Score = 31.1 bits (67), Expect = 6.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P PPPP G G F P PP P PP G Sbjct: 104 PPPPPPPPPPGLGLGF--PMAHPPNLGPPPPLRVG 136 >BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. Length = 894 Score = 31.1 bits (67), Expect = 6.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P PPPP G G F P PP P PP G Sbjct: 103 PPPPPPPPPPGLGLGF--PMAHPPNLGPPPPLRVG 135 >AK129677-1|BAC85214.1| 168|Homo sapiens protein ( Homo sapiens cDNA FLJ26166 fis, clone ADG02852. ). Length = 168 Score = 31.1 bits (67), Expect = 6.4 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 531 RGXXGXFXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXP 644 RG G P + PPPP PPP PP P P Sbjct: 60 RGLRGASDPAARAPPPPRAPPPP--PPPPLPPVLAPLP 95 >X07516-1|CAA30394.2| 297|Homo sapiens salivary proline-rich protein protein. Length = 297 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 60 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 92 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 121 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 153 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 182 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 214 >S80905-1|AAB50686.1| 382|Homo sapiens Con1 protein. Length = 382 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 20 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 52 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 81 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 113 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 143 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 175 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 205 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 237 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 267 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 299 >S62941-1|AAB27289.1| 358|Homo sapiens Ps 2 protein. Length = 358 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 60 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 92 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 121 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 153 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 182 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 214 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 243 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 275 >S62928-1|AAB27288.2| 297|Homo sapiens PRB1M protein precursor protein. Length = 297 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 60 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 92 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 121 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 153 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 182 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 214 >S52986-1|AAA13341.2| 331|Homo sapiens basic salivary proline-rich protein protein. Length = 331 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 94 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 126 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 155 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 187 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 216 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 248 >M97220-1|AAB05816.1| 331|Homo sapiens salivary proline-rich protein protein. Length = 331 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 94 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 126 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 155 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 187 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 216 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 248 >K03208-1|AAA60189.1| 251|Homo sapiens PRB2 protein. Length = 251 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 12 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 44 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 136 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 168 >K03204-1|AAA60185.1| 331|Homo sapiens PRB1 protein. Length = 331 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 94 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 126 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 155 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 187 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 216 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 248 >D89501-1|BAA13971.1| 134|Homo sapiens PBI protein. Length = 134 Score = 30.7 bits (66), Expect = 8.4 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 531 RGXXGXFXPQKKXPPPPXGX--GXXFLXPPPXPPXKNP 638 RG G + P PPPP G F+ PPP PP P Sbjct: 24 RGPRGPYPPGPLAPPPPPRFPFGTGFV-PPPHPPPYGP 60 >BC096212-1|AAH96212.1| 162|Homo sapiens PRB3 protein protein. Length = 162 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + PPP G PPP + P PP GG Sbjct: 116 PGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 150 >BC096211-1|AAH96211.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + PPP G PPP + P PP GG Sbjct: 263 PGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 >BC096210-1|AAH96210.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + PPP G PPP + P PP GG Sbjct: 263 PGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 >BC096209-1|AAH96209.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P + PPP G PPP + P PP GG Sbjct: 263 PGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 >BC044827-1|AAH44827.1| 338|Homo sapiens PRB2 protein protein. Length = 338 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 101 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 133 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 162 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPQQGG 194 Score = 30.7 bits (66), Expect = 8.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P K PPP G G PPP PP K PP GG Sbjct: 223 PGKPQGPPPQG-GNQPQGPPP-PPGKPQGPPPQGG 255 >BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subunit 19 protein. Length = 194 Score = 30.7 bits (66), Expect = 8.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 549 FXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 F Q PPPP G PPP PP PP GG Sbjct: 8 FGAQADPPPPPTALGFGPGKPPPPPP-----PPAGGG 39 >BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IMAGE:3895048) protein. Length = 205 Score = 30.7 bits (66), Expect = 8.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 549 FXPQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 F Q PPPP G PPP PP PP GG Sbjct: 8 FGAQADPPPPPTALGFGPGKPPPPPP-----PPAGGG 39 >AL646016-1|CAI17009.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P+ PPPP G PPP P P PP G Sbjct: 1290 PRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1324 >AL590490-1|CAH70931.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P+ PPPP G PPP P P PP G Sbjct: 1290 PRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1324 >AL513342-1|CAI17121.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P+ PPPP G PPP P P PP G Sbjct: 1290 PRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1324 >AL359918-1|CAI15795.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 555 PQKKXPPPPXGXGXXFLXPPPXPPXKNPXPPXXGG 659 P+ PPPP G PPP P P PP G Sbjct: 1290 PRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1324 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 30.7 bits (66), Expect = 8.4 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 573 PPPXGXGXXFLXPPPXPPXKN-PXPPXXGG 659 PPP G PPP PP N P PP GG Sbjct: 339 PPPSSAGPP--PPPPPPPLPNSPAPPNPGG 366 >AJ277365-1|CAC10539.1| 796|Homo sapiens polyglutamine-containing protein protein. Length = 796 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 569 PPPPXGEXGXXFGPPXPXPXXKPXXPXXXGG 661 PPPP G GPP P P P P GG Sbjct: 272 PPPPPHALGSR-GPPTPAPPGAPGGPACLGG 301 >AB058768-1|BAB47494.1| 723|Homo sapiens KIAA1865 protein protein. Length = 723 Score = 30.7 bits (66), Expect = 8.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 569 PPPPXGEXGXXFGPPXPXPXXKPXXPXXXGG 661 PPPP G GPP P P P P GG Sbjct: 199 PPPPPHALGSR-GPPTPAPPGAPGGPACLGG 228 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,169,037 Number of Sequences: 237096 Number of extensions: 1935624 Number of successful extensions: 14321 Number of sequences better than 10.0: 118 Number of HSP's better than 10.0 without gapping: 4436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10716 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12991778748 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -